Rocketboom Archives:

Wednesday, July 16, 2008: Village Phones in Uganda

Rocketboom field correspondent Ruud Elmendorp investigates the village phone project bringing affordable telecommunication service to rural areas in central Uganda.

Continue reading "rb_08_jul_16"

permanent link

Tuesday, July 15, 2008: To the End of Earth and Beyond

Send Your Name to the Moon, Creepy Japanese Crawling Robot, 2012 Supplies - Everything needed to survive 2012, Escape 2 Earth - The Novel!, Save the Clock Tower Flyer, More Fireworks, SETI Adopt a Scientist

Continue reading "rb_08_jul_15"

permanent link

Daily News for Monday July 14th, 2008

Bastille Day, Louis VIII of France, About Billy the Kid, Large denominations of United States currency, Instant Origami, Internet Based Political "Meta-Party" For Massachusetts , Large Hadron Collider Countdown, for the Large Hadron Collider, Easy Boiled-Egg Shaper, USB Necktie, Chicago Man Stakes Claim to Outer Space (May, 1949), iPhone2 by David Jr

Continue reading "rb_08_jul_14"

permanent link

Casual Friday July 11, 2008 : iPhone Supercut

Story Links: Joanne contributes to the madness, er, excitement!..surrounding the release of the second generation Apple 3g iPhone. Bill Gates responds, says uh. List of more Supercuts from Waxy.

permanent link

Thursday, July 10, 2008: Understanding The Rising Cost of Food

G8, 34th G8 Summit in Hokkaidō, Japan, The Cost of Food: Facts and Figures, Food Prices on the Rise, World Commodity Prices from 2000-2008, Percent change in food prices from 2007 to 2008, The Rising Demand for Commodities, Does Ethanol Deserve the Blame for Rising Food Prices?, Surface Air Temperature Increase 1960 to 2060, Income Spent on Food 2006, The World's Growing Food-Price Crisis , Rich country leaders wrestle with shaky world economy

Continue reading "rb_08_jul_10"

permanent link

Wednesday, July 9, 2008: Green Computing in Uganda

Rocketboom field correspondent Ruud Elmendorp looks into the establishment of Green Computers Uganda, a public-private partnership to sell refurbished computers and spur computer use in Kampala, Uganda.

Continue reading "rb_08_jul_09"

permanent link

Tuesday, July 8, 2008: Future McFlys, Past Videos, & Current Happiness

What Is The Oldest YouTube Video?, Me at the Zoo Uploaded on April 23 2005, The McFly 2015 Website, Back to the Future McFly Sneakers Unboxed Going for $2,000, Save The Clock Tower, Back To The Future Prop Collection on eBay, Denmark Is The World's Happiest Nation, 10 unconventional scholarships, ultimate swing tricks, swing tricks, The Grass Scanner

Continue reading "rb_08_jul_08"

permanent link

Monday July 7, 2008 : World Record iPhone Line

A week before the release of the new 3G iPhone, several people have formed a line outside of the Apple 5th Avenue cube store in New York City in hopes of obtaining a World Record for the most time spent waiting in line for a purchase.

Continue reading "rb_08_jul_07"

permanent link

4th of July, 2008 : Largest Fireworks Display in US

Forth of July, Independence Day Fireworks, New York City 2008 (more explosives than any other display in America), Star Spangled Banner by Fred Waring and his Pennsylvanians

Continue reading "rb_08_jul_04"

permanent link

Thursday, July 3, 2008: How To Make Do With What You Have

Milky Way Loses Two Arms, Jim Abbott, Lt. Dan, Galileo, Copernicus, Copernicanism, Fixed Earth Believers, Keanu Reeves at Thespian Net, There's A Bomb On The Bus What Do You Do What Do You Do?, Knit Yarn Spock Ears, Explosion containment net Patent, Half RV, Half Houseboat, Cool Amphibious Manufacturers International, Ian Usher Sold His Life On eBay for Three Hundred and Ninety Nine Thousand Dollars, Ian Usher on Ustream, Instant Origami

Continue reading "rb_08_jul_03"

permanent link

Wednesday, July 2, 2008: The Man Behind The (Podington) Bear

Joanne interviews the creator and composer behind Podington Bear, artist and musician Chad Crouch. additional story links: Hush Records, The Decemberists, This American Life, Esperanza Spalding, Daytrotter

Continue reading "rb_08_jul_02"

permanent link

Tuesday July 1, 2008: Total Chaos

story links: chaos theory (via), gaston julia, julia set, benoit mandelbrot, madelbrot set, fractals, earthquake predictions chaos, darpa security chaos, artificial intelligence chaos, pathology chaos, cardiology chaos, invader set

Continue reading "rb_08_jul_01"

permanent link

Monday, June 30, 2008: Bots, Mods, and Secret Cheat Codes by Michelangelo

Spore Creature Creator Sporepedia, Japanese Water Powered Car Mod, The Genepax Water to Hydrogen Fuel System, Amphibious snake-like robot ACM-R5, via GeekAlerts, 'Lost' Amazon Tribe Wasn't Lost, Original Rocketboom Blog Post on the 'Uncontacted' Tribe, Michelangelo 'hid secret code in Sistine Chapel frescoes, , University of Texas at Austin, Air hockey playing robot, Simpsons Map Mod for Quake III, US will remove 'terror' tag on North Korea, Ads on Wedding Cards and Selling Twitter Backgrounds, The Image Fulgurator, Rocketboom Wiki Page on Barack Obama, Rocketboom Wiki Page on John McCain

Continue reading "rb_08_jun_30"

permanent link

Friday, June 27, 2008: The Coney Island Mermaid Parade

Visiting the 2008 Coney Island Mermaid Parade at Coney Island, Brooklyn, NY

Continue reading "rb_08_jun_27"

permanent link

Thursday, June 26, 2008: Throat Toast

Story Links: Les Androides street performers, Highest Popping Toaster In World, Spinout on an escalator, El Toro Marine Corps Air Station, El Toro Missile Silos For Rent or Lease, Asimo the Robot Dances, Tay Zonday Discusses Peak Oil, Inside John McCain's Head, Rocketboom Wiki Page on Barack Obama, Rocketboom Wiki Page on John McCain, Inuit Throat Singers, of Cape Dorset, Nunuvut, Canada, Classic Rocketboom episode on Throat Singers by field correspondent Milt Lee

Continue reading "rb_08_jun_26"

permanent link

Wednesday June 25, 2008 : Woden Hump Day Robot Sale

Story Links: Wednesday hump day of Woden and Mercury, 25 is the smallest square that can be written as the sum of two squares, Magibon, Ian Usher is selling his whole life on ebay, Aucution:, Onion Ring Peace sign, Smiling French Fry, Jesus Figure in a ptoato chip, Evil Satanic Long John Silvers Crumb, Jesus Image on a Rock, Bullwinkle in a pickle, Yellow Seek and Find Yellow Drum Machine Bot, The Trons, Instruments made out of cardboard, Leave it to Roll-Oh

Continue reading "rb_08_jun_25"

permanent link

Tuesday June 24, 2008 : Pharmaceutical Drug Abuse in Nairobi

Story Links: Rocketboom field correspondent Ruud Elmendorp covers pharmaceutical drug abuse in Nairobi, Kenya. For more reports from Kenya, see the Rocketboom Wiki on Kenya

Continue reading "rb_08_jun_24"

permanent link

Monday, June 23, 2008 : Mars Snail Mail

Story Links: Disappearing Ice on Mars, Sublimation Explained, The Great Planet Debate, One Red Paperclip (the book), RealSnailMail is Real Mail via RFID chips on Real Snails, Where The Hell Is Matt 2008, Image Credits: icecubes, mars animation, mars ice cap, Pluto a planet again, spirit and odyssey, phoenix, reconaissance orbiter, esa orbiter, mars global surveyor

Continue reading "rb_08_jun_23"

permanent link

Casual Friday June 20, 2008 : First Day of Summer

Story Links: Summer Solstice, Music: Squirell Commotion by Podington Bear

Continue reading "rb_08_jun_20"

permanent link

Thursday June 19, 2008: Musical Type

Joanne plays the keyboard.

Continue reading "rb_08_jun_19"

permanent link

Wednesday, June 18, 2008: Webby Awards 2008 - On The Red Carpet with Joanne

On the red carpet of the 2008 Webby Awards with Seth Meyers of Saturday Night Live, Ben Huh of I Can Has Cheezburger, Ludacris of WeMix.com, Shawn Hardin of Flock, Will I Am of the Black Eyed Peas, and Arianna Huffington of the Huffington Post, earlier Rocketboom coverage of the Webby Film and Video Awards.

Continue reading "rb_08_jun_18"

permanent link

Tuesday, June 17, 2008: Battle of the Browsers - Firefox 3 vs Internet Explorer 7

Battle of the Browsers continued, Firefox vs Internet Explorer, Classic Rocketboom episode from Firefox Release 2, Music Invisible Is Not Invincible by Podington Bear

Continue reading "rb_08_jun_17"

permanent link

Monday June 16, 2008 : Bloomsday Plutoid Spores

Story Links: Leopold Bloom Bloomsday, Oshea's in Dublin live cam, Deep sea creature, Spore demo by Will Wright, Download Spore Creature Creator, Spore creature creator demo screen captures, Caring Continuum Chart, Childrens drawings into photos by Yeondoo Jung, Rocketboom field correspondent John Coffy covers Odunde, Pluto demoted (Rocketboom archive), Pluto named Plutoid, Framed share of Disney and Atari, Screen Actors Guild Set for possible strike, Firefox 3

Continue reading "rb_08_jun_16"

permanent link

Friday June 13, 2008 : Iraq Today

Story Links: Iraq Tag Galaxy, Iraq on Arc, Iraq on Kartoo, Iraq Newsmap, Obleek Iraq War Coalition Fatalities, Iraq on Flickr, Iraq on News Spectrum, Iraq on Bigspy, Iraq on Summize, Iraq on Stack, Iraq on Think Map Visual Thesaurus, Iraq on Google News Cloud, Iraq on Searchme Visual search, Music: Pythagorean Theorem by Podington Bear

Continue reading "rb_08_jun_13"

permanent link

Thursday June 12, 2008 : Wiimbledon

Story Links Wiimbledon 2008, Barcade, music by Podington Bear, Wiimbledon 2007 by Rocketboom

Continue reading "rb_08_jun_12"

permanent link

Wednesday June 11, 2008 : 2008 Webbys Video and Film Awards

Story Links: Winners of the Webbys 2008 Online Film and Video Awards Including interviews with Richter Scales, 30 Second Bunnies Theatre , Tay Zonday, DailyGreens, Diggnation, Totally Rad Show, You Suck at Photoshop, Wainy Days Music: Podington Bear. See also, Rocketboom at the Webbys 2007

Continue reading "rb_08_jun_11"

permanent link

Tuesday, June 10, 2008: Iraq and Afghanistan Veterans of America

story inks: robert millis of american microphone interviews 1st lt. paul rieckhoff founder of iraq and afghanistan veterans of america, george bush responds to a question about private contractors, audit finds u.s. hid actual cost of iraq projects, contractors in iraq make costs balloon

Continue reading "rb_08_jun_10"

permanent link

Monday, June 9, 2008: The Private War Contract

story links: Blackwater, Representative Waxman on Blackwater, DynCorp, KBR private contractor job listings, Army Pay 2007, Additional figures on security contractors, Council on Foreign Relations, memo to Oversight Committee October 1st 2007, Co-written by Hal MacDermot

Continue reading "rb_08_jun_09"

permanent link

Friday, June 6, 2008: Coney Island

story links: final times for coney island's astroland, music by kris

Continue reading "rb_08_jun_06"

permanent link

Sounds of Chinatown

Immersive composition of looping sounds from the streets of Chinatown.

Continue reading "rb_08_jun_05"

permanent link

Wednesday, June 4, 2008: Epistemology

What is Epistemology?, Thales says Everything is Water, Anaximander says Everything is Air, Rene Descartes, Discourse on the Method of Rightly Conducting One's Reason and of Seeking Truth , Skepticism entry at the Stanford Encyclopedia of Philosophy, The New England Skeptical Society, music by podington bear (nature kid), image credits: leap, annonymous, god hands, puppeteer, brain in vat, baby hands, bre, brain messages, scary girl, poltergeist kid, trees, fame guy, brain neurons, space pics (1, 2)

Continue reading "rb_08_jun_04"

permanent link

Wednesday, June 3, 2008: Finding Shelter For 2,000 Refugees in Johannesburg

Rocketboom field correspondent Ruud Elmendorp reports on the story of some 2,000 refugees seeking safety in the Methodist Church in the wake of the recent xenophobic attacks in Johannesburg, South Africa.

Continue reading "rb_08_jun_03"

permanent link

Monday, June 2, 2008: Body Vandals, Snails in the City, and Hitler the Hippie

How to Siphon Gas from a Newer Vehicle, Paintings by Hitler purchased and remixed, for the show If Hitler Had Been a Hippy How Happy Would We Be, Body Vandals, slam!, Running into the garage door, Kid vs Garage Door, Inner city snail, Painting Chewing Gum revisited, Rome sacked by Geiseric the Lame, Big Plushies on the Streets of Hong Kong, Wall Street Bull, Signs of Spring by Mark Jenkins

Continue reading "rb_08_jun_02"

permanent link

Casual Friday, May 30, 2008: 28 Hours in Jyväskylä

Rocketboom Spotlight: 28 Hours of Jyväskylä, a time-lapse film shot in high definition video by Neo Kekkonen in Jyväskylä, Finland.

Continue reading "rb_08_may_30"

permanent link

Thursday, May 29, 2008: Old School Webcams, New School Lifestreaming

The Internet Bench from Gdansk, Poland, The Cat Residence, Watching Plants Grow, Watching Pigs Grow, The Church of St. George located Sofia, Bulgaria, the cyber-enabled single crystal X-ray diffraction facility at Case Western Reserve University, Bridge in Umeå, Sweden, D & D Family Billiards in Thorndale, Pennsylvania, Universeum in Göteborg, Sweden, Plusnet Customer Support Center, Ustream, Justin.tv, Real Tokyo Life, SpaceVidcast, Nekomimi Lisa, KCJJ Raw, Live From The UK, Austincast, Zane Savage Live, Laura News, Louiscast, Music by Podington Bear

Continue reading "rb_08_may_29"

permanent link

Wednesday, May 28, 2008: Anti-Immigrant Violence in South Africa

Rocketboom field correspondent Ruud Elmendorp reports on the rise of anti-immigrant violence in Johannesburg, South Africa.

Continue reading "rb_08_may_28"

permanent link

Tuesday May 27, 2008 : Wearable Mars Pizza Pork Bean Burger Dance

Story Links: Eating a burger, NASA's Phoenix Lands and is ready to report, Is this the way to Amarillo?, Cold fusion created in labs, Weezer Music Video Meme Pork & Beans, Video Pizza, 1979 performance of Adrian Mumsey's The Lost Sheep, Wearable Motorcycle, Two-wheel Uno motorcycle, Mr. Toledano's photo galley of bankrupt offices, Babies who get jumped, Horse Dance, We are the World Japan

Continue reading "rb_08_may_27"

permanent link

Monday May 26th, 2008 : Memorial Day

Story Links: Memorial Day, Henry C Welles, Waterloo, New York, Comparative death rates of selected US wars from 1775 - 2008, Documented civilian deaths from Iraq War, Military and civilian war related deaths through the ages

Continue reading "rb_08_may_26"

permanent link

Sunday May 25, 2008 : Is This the Way to Amarillo?

Story Links: Troops in the Royal Dragoon Guards at the Al Faw base redo Is This the Way to Amarillo? (by Tony Christie and mimed by Peter Kay)

Continue reading "rb_08_may_25"

permanent link

Casual Friday May 23, 2008 : Burger

Video response to Andy Warhol eating a hamburger.

Continue reading "rb_08_may_23"

permanent link

Thursday, May 22, 2008: Human Rights Video with Witness.org

Joanne visits Peter Gabriel's human rights video organization Witness.org in Brooklyn, NY.

Continue reading "rb_08_may_22"

permanent link

Thursday May 21, 2008 : Painting Chewing Gum

Story Links: Artist Ben Wilson paints pictures on chewing-gum left on the streets of High Barnet, North London.

Continue reading "rb_08_may_21"

permanent link

Why Tuesday May 20, 2008 : Electing Al

Story Links: Muto graffiti animation in Buenos Aires by BLU, Rocketboom field correspondent Jacob Soboroff of Why Tuesday? on today's mail-in primary voting, Study on trust in the US federal government, German speaking Rocketboom field correspondent /SMS ;) speaks with riz khan of Al Jazeera at the St. Gallen Symposium, Aluminum, Shrubbery Camouflage Helmet, Number of horns on a unicorn multiplied by the answer to life, the universe and everything furlongs, How many cannibals can your body feed quiz, Study links cell phone use near children with hyperactivity and other behavioral problems

Continue reading "rb_08_may_20"

permanent link

Monday May 19, 2008 : Representational News

Story Links: Icahn has Cheeseburger (shareholder but not board member) to overtake Yahoo! board, Yahoo! Board of Directors, Who is your Yahoo Pick?, Moot, 4chan (photo), Jay Maynard, Tron Guy (video, image), Michael Arrington, Techcrunch (photo), Admiral Ackbar, Mon Calamari commander of the Rebel Fleet, Tay Zonday, Tazonday.com (photo), George Bush, soon to be former politician, Michael Buckley, What the Buck, Tom Dickson, Will it Blend
(photo), Nick Drake, Five Leaves Left (photo), Nemo, Disney, Including music by Podington Bear - Hook line and Slinker and Bobby Birdman, , How to eat bananas by Sara M. Brattman, New York Times article on Aya Tsukioka and Urban Camouflage in Japan, colored pencils in the woods (via), Makeup? mountain in Peru, The virtual 2-D girlfriend projection, NYU's ITP Show Spring 2008, Door to Hell in Uzbekistan, Toccata and Fugue in D Minor on a bottle Organ, Dragostea Din Tei in G

Continue reading "rb_08_may_19"

permanent link

Casual Friday, May 16, 2008 : The Phoneheads

Story Links: Rocketboom Spotlight: Super music video, Roll That Stone, in one take with two time frames from The Phoneheads, a drum&bass group from Düsseldorf, Germany. Poor guy never gets to eat.

Continue reading "rb_08_may_16"

permanent link

Thursday May 15th, 2008 : Jake and Amir

Story Links: NYC Videoblogging Meetup featuring Jake and Amir. Music by Podington Bear.

Continue reading "rb_08_may_15"

permanent link

Wednesday, May 14, 2008: Anti al-Qaeda Sunni Militias in Iraq

Alive In Baghdad reports on the formation of a citizen militia to fight al-Qaeda in the Adhamiya neighborhood of Baghdad, Iraq.

Continue reading "rb_08_may_14"

permanent link

Tuesday, May 13, 2008: Sail-bots, Hidden McCain, and the Emergency Party Button

U.S. declares war on Mexico, Mexican-American War, General Ulysses Grant, Stephen Colbert's Birthday, Stephen Colbert for President 2008!, , Democrats revive Internet Freedom and Non-discrimination Act, David Lynch's Daily Weather Report, Foreclosure auction on Michael Jackson's Neverland Ranch canceled, Sail-bot to cross the Atlantic, The Emergency Party Button, John McCain’s hiding in your news open, God Sends His Only Severe Thunderstorm To Jenna Bush's Crawford Wedding, Terrafugia's Drivable Airplane, おおっと!

Continue reading "rb_08_may_13"

permanent link

Monday, May 12, 2008: JFK's Air Guitar, Red Giants, and the End of Everything

JFK Air Guitar fetches $5000 on Ebay, The End of Everything, Phoenix to Land on Mars, The National Center for Remote Sensing, Air and Space Law, via Space.com, Red Giants, Kitts Peak National Observatory, Astronomers begin search for 'vanishing' stars, Shuttle Astronauts Rehearse Launch Day, Extra Joanne's Best Alternate Take

Continue reading "rb_08_may_12"

permanent link

Casual Friday May 09, 2009 : Bathtime in Clerkenwell

Story Links: Bathtime in Clerkenwell animation by Alex Budovsky, Music: The Real Tuesday Weld with Stephen Coates based on "Sweeter Then Shugar" by the Mills Brothers

permanent link

Thursday, May 8, 2008: International Day of Numbers

Story: International Day of Numbers, Music: Airliner

Continue reading "rb_08_may_08"

permanent link

Wednesday, May 7, 2008: Fighting Malaria in Kenya

Rocketboom Kenya field correspondent Ruud Elmendorp investigates malaria prevention in Kenya.

Continue reading "rb_08_may_07"

permanent link

Tuesday May 6, 2008 : One Red Paper Clip

Final ROFLCon video for 2008, Kyle Macdonald of One Red Paperclip talks with Sarah Meyers of Pop17 about his book. Also, help Kyle find out who these guys are at who are these guys dot com. Music from Podington Bear. SEE ROFLCON VIDEO POOL.

Continue reading "rb_08_may_06"

permanent link

Monday May 5, 2008 : Cinco de Mayo

Story Links: History of Cinco de Mayo, When Johnny Comes Marching Home by Bonnie Hamilton and The Harmoneion Singers, Ma Petite Biote by Sylvain Piron, El Relicario / Bolero (1927) by The Gonzalez' Orchestra

Continue reading "rb_08_may_05"

permanent link

Casual Friday, May 2, 2008: Questions No Answers

Joanne meets up with davidjr.com in Union Square, NYC

Continue reading "rb_08_may_02"

permanent link

Thursday, May 1, 2008: David Weinberger on Fame

Story Links: David Weinberger at ROFLcon with a lecture on fame, Music: Flutterbee by Podington Bear.

Continue reading "rb_08_may_01"

permanent link

Wednesday, April 30, 2008: Before The LOL at ROFLCon


Jason Scott
of Textfiles walks us through a history of online linguistics at ROFLCon 2008, Special appearance by Steve Garfield, Music: Pives and Flarinet by Podington Bear.

Continue reading "rb_08_apr_30"

permanent link

Tuesday, April 29, 2008: Chuck Norris Facts at ROFLCon

Ian Spector of Chuck Norris Facts at ROFLCon, Biographical information about Chuck Norris, The Book about The Truth About Chuck Norris, Chuck Norris sues Chuck Norris Facts, Vin Diesel Facts, Snakes on a Plane at IMDB, Paris Hilton, Lindsay Lohan, Chuck Norris in Delta Force 2, Something Awful Forums, College Humor, William Morris Agency

Continue reading "rb_08_apr_29"

permanent link

Monday April 28, 2008 : The Tron Guy at ROFLcon

Story Links: Jay Maynard the Tron Guy at the ROFLcon conference, MIT. The classic tron costume page that led everyone awry. Where The Hell Is Matt? Special music thanks to podington bear, ham radio by rtpalovich, Tron on ebay, Tron Arcade, Tron Trailer (redux), Tron (imdb)

permanent link

Casual Friday April 25, 2008: Prague

Story: Rocketboom's Andrew Baron captures glass harpist, Alexander Zoltan, on the Charles Bridge in Prague, Czech Republic.

Continue reading "rb_08_apr_25"

permanent link

Thursday, April 24, 2008: Falling Spacecraft Pixel Spouts and Cloned Meat

Story Links: Trojan Horse, NASA awards new lunch services contract to SpaceX, Soyuz TMA-11 goes ballistic , Obamacrombie and Fitch Gate, The REEM-B Robot, Dean Kamen's Slightshot Water Purifier, Pixel Spout, Recycled Cell Phone Art (via Bill Pettit), Cloned Animal Meat Coming Soon, Alice Illustrations other than Tenniel, ROFLCon

Continue reading "rb_08_apr_24"

permanent link

Wednesday, April 23, 2008: Creating New Investors in Kenya

Rocketboom Kenya field correspondent Ruud Elmendorp covers the frenzy as Kenyans look to buy shares in state mobile provider Safaricom ahead of their IPO.

permanent link

Tuesday April 22, 2008 : Earth Day

Story Links Happy Earth Day! See Also: RB field correspondent Drew Olanoff dumpster dives for recyclables and Earth Day quotes.

Continue reading "rb_08_apr_22"

permanent link

Monday, April 21, 2008: Artist Alley at the 2008 NY Comic Con

Rocketboom field correspondent Juliette Powell talks with comic book artists Ramon Perez, Mark Brooks, Romain Hugault, and N. Steven Harris at the 2008 New York Comic Con. Music: Sunset Stroll Into The Woods by Podington Bear.

permanent link

Casual Friday, April 18, 2008: A New York Fairy Tale Continued

story links: A New York Fairy Tale Continued, Music - Tender & Curious by Poddington Bear

Continue reading "rb_08_apr_18"

permanent link

Thursday April 17, 2008: Underwater World Record and Eco-Awareness

story links: Joanne interviews Shaun Waterford who plans on breaking the world record for most days living underwater.

Continue reading "rb_08_apr_17"

permanent link

Wednesday April 16, 2008: Field Report: The Poor Helping the Poor at Barefoot College

Encore story links: Interview with Bunker Roy of Barefoot College (thanks, Andrew!)

Continue reading "rb_08_apr_16"

permanent link

Tuesday April 15, 2008 : International News

Story Links: Sark Island changing to democracy, Island sold on Second Life, CBS CEO gets major raise as ratings tumblr, Food Prices Have Doubled or trippled, Reverse evolution may have been witnessed as 2 species turn back into one, Nice looking Phone Watch, Arbor day, Dinner in the Sky, 170 holes in Earth, Cyborg June Beetles, Wouldnt you love to ride in my beuatiful balloon?, Horse Sled Waggon, Rotators, There is an alegator snapping turle in japan, Brain scanner, Descartes, Tomorrow is busy

permanent link

Monday, April 14, 2008

story links: Images of the Large Hadron Collider at CERN on Flickr by Zipckr, by TimTom, by Image Editor, Faces of Death nuclear bomb test, Concerned Hawaiians file suit to stop the LHC from blowing up the world, The assassination of John F Kennedy vs The assassination of Abraham Lincoln, Balloon Clothes, The Jump Bike, The Evolution of Space Debris, Satellite to be junked because lunar flyby is patented, 162 Million websites on the Internet, Stonehenge, 'Breakthrough' at Stonehenge dig, Ronald McDonald insanity, What's gonna [Donald] Donna, Donald MAD, Laugh now but one day we will meat at McDonalds

Continue reading "rb_08_apr_14"

permanent link

Casual Friday April 11, 2008 : Twitter Madness

Story: Twitter Madness. Music: Infinity.

permanent link

Thursday April 10, 2008: Dictionaraoke, Mandelbrot, Chain Surfing, Creepy Robots

story links: Dictionaraoke, Disney movies in 3D, Make magazine's Phillip Torrone covers the creepy new Segway RMP Robot, Poll: 81 Percent Think US on Wrong Track, Osamu Tezuka’s Galaxy Boy Troop puppet space opera of the early 1960's, Seed Magazine interview with Benoit Mandelbrot, Fractals, Chain Surfing, She without arm he without leg ballet, Kitty Tennis, Send Queen Rania of Jordan your stereotypes

Continue reading "rb_08_apr_10"

permanent link

Wednesday April 9, 2008: The State of Electronic Voting Machines

story links: Rocketboom field correspondent Jacob Soboroff talks to computer security expert Ed Felten of Princeton University and Freedom-to-Tinker on the state of electronic voting machines.

Continue reading "rb_08_apr_09"

permanent link

Tuesday April 8, 2008: Unexpected Extrasolar Molecules and Melting Icecaps

story links: Signs of Spring, Inflatable Animals, 6000 sq mile Wilkins Ice Shelf is breaking off, Moderate Resolution Imaging Spectroradiometer, Melting Icecaps may trigger more volcanic eruptions, WWF Paper Dispenser, Hubble finds first organic molecule on extrasolar planet, Princeton's Harry G. Frankfurt On Bullshit, Psychology of Marketing, The Potato Song, Flickr Photo Credits (Eggybird, Rob Lee, JasonTromm)

Continue reading "rb_08_apr_08"

permanent link

Monday April 7, 2008: Mechanical Oddities, Yahoo Mergers, My Little Pony Mashups

story links: Rocketboom boom mashup by Ronen, Hydrodynamic rotisseries, The Mechanical Beanstalk, 1951 Obituary Index, Jack and the Beanstalk (1952 film), Students challenged to go complaint-free, Sitar Hero, Rocketboom Blog, Magic Pen, Yahoo receives warning from the Death Star, My Little Pony-Halo Mashup, A World of Custom "My Little Pony" Toys, Charlton Heston died, Showbiz Pizza Wolfpack 5, Pizza.com sells for $2.6B dollars (via slashdot)

Continue reading "rb_08_apr_07"

permanent link

Casual Friday April 04, 2008 : Do YouTube?

Story Links: Joanne hits the streets to look for new videos to watch on YouTube and finds French Kiss New York, Monty Python Philosophy Football, Janet Rocke with U, Janet - Feedback, Kimbo Slice - The heart of a Lion

Continue reading "rb_08_apr_04"

permanent link

Thursday April 03, 2008 : New Design High

Story Links: Joanne visits the New Design High School

Continue reading "rb_08_apr_03"

permanent link

April 02, 2008 : Alien Abduction Festival

Story Links Canadian Rocketboom field correspondent Wayne MacPhail covers the Alien Abduction Festival

Continue reading "rb_08_apr_02"

permanent link

Tuesday April 1, 2009 : True News

Story Links: Alien found on the beach, Water on Mars, Looking for dark matter on the South Pole, Rick Roll direct link

Continue reading "rb_08_apr_01"

permanent link

Monday March 31, 2008 : Gamera Politics

Story Links: Earth Hour, Automatic Dance machine, John Edwards continues to make no endorsement, John Edwards on Rocketboom, Romanian Poet Nichita Stanescu was born today, President Lyndon B. Johnson announces he will not run for re-election today, Obama and Clinton continue to bicker, Texas Robo calls down and dirty, Al Gore could still run for president, Al Gore endorsement could seal fate of election, Gamera the flying turtle, Current TV, New Rocketboom Comments, RB field correspondent Andy Carvin visits the kite festival in Washington DC, RB field correspondents, Constantine maries Fausta

Continue reading "rb_08_mar_31"

permanent link

Saturday March 29, 2008 : Magibon Bombay

Story Links: Save the world from Magibon, Rocketboom, Lisa Nova, Ze Frank, Revision3, Podshow, Make your scene in seconds with Bombay.tv

Continue reading "rb_08_mar_29"

permanent link

Casual Friday Encore, March 28, 2008 : Reggie Watts

Story Links: Reggie Watts (music) | Extra: Check back for Saturday episode in Mumbai.

Continue reading "rb_08_mar_28"

permanent link

Thursday, March 27, 2008: Virtual Woman, Pregnant Man, and a Twitter Marriage Proposal

story links: Motorcycle Airbags, Motorcycle Airbags v1.0, Creepy Virtual Woman, Creepy non-Virtual Magibon, Twitter Marriage Proposal, Twitter Marriage Acceptance, Proof of Twitter Marriage Acceptance Engagment Ring, The First Twitter Marriage Proposal, The First Twitter Marriage Acceptance, Not a RickRoll, also Not a Rickroll, How To Rick Roll Someone In Real Life, Chocolate Rabbit Meltdown, Death of Chocolate Bunny, The Demise Of The Chocolate Bunny, Google maps shows drug deal, Man is five months pregnant, Cod Liver could ease joint stiffness

Continue reading "rb_08_mar_27"

permanent link

Wednesday March 26, 2008 : Sewage Disaster in East Baghdad

Story Links: The Shama’iya district in far east Baghdad is currently undergoing a major sewage disaster as polluted water fills the streets, and permeates the air. Field Report by Alive in Baghdad.

Continue reading "rb_08_mar_26"

permanent link

Tuesday March 25, 2008 : Year of The Potato Day

Story Links: Potato, The Potato Song, The United Nations declares 2008 International Year of the Potato, The World Potato Congress Incorporated Organization to meet in Christ Church New Zealand in 2009, February 54th is Day of The Potato

Continue reading "rb_08_mar_25"

permanent link

Monday March 24, 2008 : NYC Pillow Fight 2008

Story Links: NYC Union Square Pillow Fight 2008 (music) See Also: Pillow Fight 2007, Pillow Fight 2006

Continue reading "rb_08_mar_24b"

permanent link

Monday March 24, 2008 : Oil Chase and Fire

Story links: George Bush speaks at the NYC Economic Club, Joseph Stiglitz, Common trends for time travelers to Germany (via Metafilter), German gas prices reach over $8US per gallon, Dick Cheney disregards public opinion, Stiglitz is expecting $4 trillion needed to restore order in Iraq, Chevy Tahoe in Iran commercial, Yosuke Yamashita plays burning piano (new), BBC report on tent cities springing up in Los Angeles due to economy fallout, An anonymous responder to BBC's tent city story, Yosuke Yamashita plays burning piano (old), Fire Escapes in NYC, Response to Fire Escapes in NYC

Continue reading "rb_08_mar_24"

permanent link

Friday, March 21, 2008: Spring II of II

Story Links: Rocketboom New York City Music Video Week. Joanne visits the first morning of Spring (music).

Continue reading "rb_08_mar_21"

permanent link

Thursday, March 20, 2008: Spring I of II

story links: Rocketboom New York City Music Video Week. Joanne visits The Orchid Show at the New York Botanical Garden in The Bronx, NY.

Continue reading "rb_08_mar_20"

permanent link

Wednesday, March 19, 2008: Elephants on Parade

story links: Rocketboom New York City Music Video Week. The Elephants arrive in New York.

Continue reading "rb_08_mar_19b"

permanent link

Wednesday March 19, 2008 : Forward Through Backwards Time

Story Links: Rocketboom New York City Music Video Week. Encore: Joanne travels across New York City backwards through time. Eclipse Solaire by vinc2-exoplanete (music)

Continue reading "rb_08_mar_19"

permanent link

Tuesday March 18, 2008 : Miniature City

Story Links: Rocketboom New York City Music Video Week. Miniature City. Inspired by Little People. Music by Drew.

Continue reading "rb_08_mar_18"

permanent link

Monday March 17, 2008 : Fire Escape

Story: Rocketboom New York City Music Video Week. Fire Escape. Music by PQPiano3

Continue reading "rb_08_mar_17"

permanent link

Friday, March 14, 2008: I Can Has Cheezburger Panel at SXSW 2008

story links: I Can Has Cheezburger founder Eric Nakagawa and CEO Ben Huh discuss the LOLcats phenomenon during the LOLWUT? panel at the 2008 SXSW Interactive Festival.

Continue reading "rb_08_mar_14"

permanent link

Thursday, March 13, 2008: Battledecks

Story links: Battledecks contestants improvise conference presentations from previously unseen powerpoint slides. Jeff Tidwell is the moderator. Judges include Erika Hall and Jonathan Grubb. Contestants include George Kelly, Ted Rheingold, Rob Weichert, Jon Armstrong and Anil Dash.

Continue reading "rb_08_mar_13"

permanent link

Wednesday, March 12, 2008: Spotlight: Salvador Dali and Gala

story links: Rocketboom Spotlight: Salvador Dali and Gala

Continue reading "rb_08_mar_12"

permanent link

Tuesday March 11, 2008 : Richard Garriot takes Steve Brudniak's Art into Space

Interview with Austin artist, Steve Brudniak and his latest art work which will be carried to the the International Space Station by private citizen and game developer Richard Garriot.

Continue reading "rb_08_mar_11"

permanent link

Monday March 10, 2008 : SXSWi Open

This scene might look like a crowd of people leaving a lacy keynote but it's just the beginning of wonderful things to come from SXSW in Austin, Texas. Such as, I CAN HAS CHEEZBURGER. Stay tuned for more than your normal releases this week.

Continue reading "rb_08_mar_10"

permanent link

Friday, March 7, 2008: Casual Friday: New York City 1911-Present

story links: New York City 1911-Present, by Adam Quirk of Wreck and Salvage, NYPL Digital Gallery, video of the Empire State Building, music by Dosh

Continue reading "rb_08_mar_07"

permanent link

Thursday, March 6, 2008: Rocketboom's Ellie Rountree visits Toy Tokyo

story links: Rocketboom's Ellie Rountree visits Toy Tokyo in New York City.

Continue reading "rb_08_mar_06"

permanent link

Wednesday, March 5, 2008: Mars Hands Burgers to Pole Position

story links: Avalanche on Mars, Human Pole Position, Kanye Hands, Moses was on psychedelics, H.R. Pufnstuf, Bush and Cheney wanted for Crimes Against our Constitution, How To Write Humor, Hamburger Dress, Bayonets Thrust into Snow Man by Soldiers at Practice, Easy Do-It-Yourself Ghost, Hibernating Tortoises, Sometimes Red, Sometimes Blue, yet another worthless website dot com, Definitely, Desperate Housewives The Musical, Am I Awesome dot com

Continue reading "rb_08_mar_05"

permanent link

Tuesday, March 4, 2008: Field Report: Recycling Construction Waste

story links: RB Field correspondent Steve Garfield interviews Paul Gurspan of Special Project Management on recycling construction waste in Boston.

Continue reading "rb_08_mar_04"

permanent link

Monday, March 3, 2008: Intellectual Property Donor Cards, UFOs, Longplayer

story links: Princes of Antioch, Organ Donor Cards,  Intellectual Property Donor Card, Fail Dogs, Unexplained Force Objects, Chaos Theory, Robert Scoble on FastCompany.tv, Longplayer plays without repetition for over 2984 days

Continue reading "rb_08_mar_03"

permanent link

Casual Friday: February 29, 2008: Ransom - The Lost Episode

story link: Ransom.

Continue reading "rb_08_feb_29"

permanent link

Thursday, February 28, 2009: Leap Year Day

story links: artist Brian Feldman celebrates Leap Year Day.

Continue reading "rb_08_feb_28"

permanent link

Wednesday, February 27, 2008: Spotlight: Andy Warhol

story links: Rocketboom Spotlight: Andy Warhol

Continue reading "rb_08_feb_27"

permanent link

Tuesday, February 26, 2008: Whole Packaged Human, Disco Bambina, & Amphibious Cars

story links: stick-on-eyes, deli-packaged whole human, rinspeed amphibious sports car, 1930's movie theater of the future, plant-to-twitter plugin, 867-5309 wiki, Ransome, The Epoch of Ptolemy's Nabonassar, Новый год, Disco Bambina

Continue reading "rb_08_feb_26"

permanent link

Monday, February 25, 2008: Mind Control, Nader, and iBand

story links: Brain control gaming headset, Ralph Nader to run for president again, iBand, Entramado, Camouflage photography (via), Stars in Your Lap, with Joanne, Alex Albrecht of Diggnation, Xeni Jardin and Mark Frauenfelder from Boing Boing and Ze Frank, Earth to meet with fiery demise in 8 billion years, Hungarian car wash commercial, Soviet Big Childrens' Choir, The Dark Side of Rose

Continue reading "rb_08_feb_25"

permanent link

Casual Friday: February 22, 2008: Joanne's Inner Soundtrack (by Paul Dateh)

story links: Paul Dateh (aka the Hip-Hop Violinist) interprets Joanne's day.

Continue reading "rb_08_feb_22"

permanent link

Thursday, February 21, 2008: Darkest Side of the Moon

story links: Footage from the February 20-21 2008 total lunar eclipse captured with a Red One digital camera. (thanks, Ian!) More to come later.

Continue reading "rb_08_feb_21"

permanent link

Wednesday, February 20, 2008 : The Art and Science of Perfume

story links: interview with perfumist Douglas Hopkins on the art and science of perfume.

Continue reading "rb_08_feb_20"

permanent link

Tuesday, February 19, 2008 : MediaStorm

Interview with multimedia production company MediaStorm. For extended interview with Brian Storm, see part II [flash|mov|wmv]

Continue reading "rb_08_feb_19"

permanent link

Monday February 18, 2008 : Speechless

Story Links: Magibon, Dramatic Lemur, Big Black Staring Contest, Charlie Chaplin Table Ballet, Fat Cat on Couch, 4:33 by John Cage, The Pirate Mime

Continue reading "rb_08_feb_18"

permanent link

Casual Friday February 15, 2008 : Cryptoe

Story Link: Talk:The Ransom

Continue reading "rb_08_feb_15"

permanent link

Thursday, February 14, 2008 : Valentine's

Happy Valentine's day from the vegetables.

Continue reading "rb_08_feb_14"

permanent link

Wednesday February 13, 2008 : Field Report - Kenya

Story Links: Rocketboom field correspondent Ruud Elmendorp reports from Kenya on the status of the election crisis. For more information see the Rocketboom wiki on Kenya.

Continue reading "rb_08_feb_13"

permanent link

Tuesday February 12, 2008 : Evolution Explainer

Story Links: Happy 199th birthday to Charles Darwin, Evolution, animation in collaboration with Adam Quirk of Wreck and Salvage

Continue reading "rb_08_feb_12"

permanent link

Monday February 11, 2008 : Anonymous International Protests of Scientology

Story links: Anonymous stages protests against the Church of Scientology in cities around the world. Rocketboom field correspondents covered the event Andy Carvin - Washington D.C., Steve Garfield - Boston, John Coffey - Philadelphia, Juliette Powell - New York City, Neutral News - Miami, Londanon - London

Continue reading "rb_08_feb_11"

permanent link

Thursday February 7, 2008 : Artificial Time Travel

Story Link: Joanne interviews Jamie O'Shea on his experience traveling through an artificial time warp.

Continue reading "rb_08_feb_07"

permanent link

Wednesday Feb 6, 2008 - Know Your Meme : Cory's Sunglasses

Story Links: Know Your Meme, What ever happened to Corey Worthington Delaney and his Famous Glasses?, Cory Delaney's fame attributed to A Current Affair and Tonight Today Australian TV programs, I Like Turtles, I like Turtles Kid Speaks out about why he likes Turtles, Mooninite Boston Bomb LED Auqa Teen Hunger subway scare, Cory gets an agent, Cory Wannabe, Leave Cory Alone, Cory the gang fighter

Continue reading "rb_08_feb_06"

permanent link

Tuesday, February 5, 2008 : Religion and Politics

Story Links: Rocketboom field correspondent and The Uptake producer Chuck Olsen covers the religious, back-country vote of Tennessee.

Continue reading "rb_08_feb_05"

permanent link

Monday February 4, 2008 : Across the Universe

Story links: Leap Year, Improv Everywhere's Frozen in Grand Central Station, Noisy New York Superbowl roar (fan images), Patriots accused of cheating by US senate (Thanks, Gary V and Bill D!), Patriots Quarterback Tom Brady poses as Tom Brady from the Brady Bunch (via), Internet Traffic Report (Related: Pentagon report on the inetrnet as a weapons system), The Smiling Crator happy face of Mars, STS-122 Space Shuttle Atlantis to begin launch countdown to the International Space Station, NASA Deep Space Nine to beam the Beatles song Across the Universe

Continue reading "rb_08_feb_04"

permanent link

Causal Friday February 1, 2008 : Pi Song

Story Link: pi

Continue reading "rb_08_feb_01"

permanent link

Thursday January 31, 2008 : Wisdom of the Crowds

Story links: Rob Malda a.k.a. CmdrTaco, Slashdot, Images Credits (1, 2, 3, 4, 5, 6), Idle, New York Times on Wisdom of the Crowds, Digg changes algorithm, Cheeseburger in a can (via), Reddit, Hard road ahead for Fox News, They, Gamera, Andy Plesser of Beet.TV interview with Jim Diaz, head of strategy at Vuse, formally Azereus about his P2P user base vs. Joost, The Lonely Amoeba

Continue reading "rb_08_jan_31"

permanent link

Wednesday January 30, 2008 : Gold Trade in Iraq

Story: Alive in Baghdad on the state of gold in Iraq

Continue reading "rb_08_jan_30"

permanent link

Tuesday January 29, 2008 : How To Buy The Moon

Story Links: The Moon, Lunar Registry, Moon Treaty, International Waters, Antarctica, International Space Law, Moon Energy, Helium-3

permanent link

Monday January 28, 2008 : World War Internet

Story Links: Ludolph van Ceulen of Fildesheim Germany calculated Pi to 35 places, Pi Song, Simulation of Astroid attacking Dianasours, Nick Denton of Gawker attacks Church of Scientology (Photo by Dave Winer), Anonymous threatens Scientologists, YouTube Prince Mr. Feth provokes Anonymous, Christiantology threatens everyone, Out of control US Spy Satellite could cause major damage to Earth, Richard Branson Interview by Sarah Meyers

Continue reading "rb_08_jan_28"

permanent link

Casual Friday January 25, 2008 : The Lost Sock

Story: Where lost socks go

Continue reading "rb_08_jan_25"

permanent link

Thursday January 24, 2008 : Dense News

Story Links: The search for a good pot dealer, Robot in Japan controlled by monkey in US, Watching paint dry, Paint dry watching expert, Hardcore paint drying, Wikiboom collection of paint drying videos, Historical party in Melbourne with Corey Delaney and his famous sunglasses, Star Wars on bagpipes and Guinnes, Tom Cruise - The Freedom Medal Award Ceremony, Test tube universe nearest to absolute zero

Continue reading "rb_08_jan_24"

permanent link

Wednesday January 23, 2008 : Kenya Crisis Continued

Story Links: Rocketboom field correspondent Ruud Elmendorp reports from Kenya. For updates, links and ways to help, see the Rocketboom Wiki on Kenya.

Continue reading "rb_08_jan_23b"

permanent link

Wednesday, January 23, 2008 : Kenya Crisis

Story Links: Rocketboom field correspondent Ruud Elmendorp is stationed in Kenya and continues to release more reports on the crisis. Additional footage and updates on the Rocketboom Wiki.

permanent link

Tuesday January 22, 2008 : Wine Tasting with Wine Library TV

Rocketboom Interview with Gary Vaynerchuk of Wine Library TV, Wine Library TV interview with Rocketboom

Continue reading "rb_08_jan_22"

permanent link

Casual Friday January 18, 2008 : A World of LP Portraits

story links: a world of lp portraits (inspired by the flickr group LP Portraits)

Continue reading "rb_08_jan_18"

permanent link

Thursday January, 17, 2009 : Gizmodogate

Story Links: Joanne interviews Gizmodo's Richard Blakeley who used the TV-B-Gone remote control to make a video of himself turning off TV's during presentations at the 2008 CES conference in Las Vegas, [Photo Credits: (1) by Brian Solis, (2) by jonl,] | Extra: Ongoing Rocketboom coverage of Kenya

Continue reading "rb_08_jan_17"

permanent link

Wednesday January 16, 2008 : Kenya Post-Election Market Stress

Rocketboom Kenya field correspondent Ruud Elmendorp uncovers the effect of post election instability on regional tourism.

Continue reading "rb_08_jan_16b"

permanent link

Wednesday January 16, 2008 : Kenya Post-Election Displacement

Rocketboom Kenya field correspondent Ruud Elmendorp covers displaced villagers in Nakuru

Continue reading "rb_08_jan_16"

permanent link

Tuesday January 15, 2007 : The Social Construction of Reality

Story Links: The Social Construction of Reality, Apple is in the air, LP portrait record collection flickr pool, Jamie O'shea still travels slowly through time, Ubuntu Ruby Tutorial, NASA's Hubble finds Double Einsteing Ring, Superelectronic (via), Superbad, Jodi.org, Subliminal candidate face morphing to persuade voters, Star Wars Guide to the Candidates, Super run of hardest video game in the world 'I wanna Be the Guy'

Continue reading "rb_08_jan_15"

permanent link

Monday January 14, 2008 : Time Delay & Deep Space

story links: Jamie O'Shea is locked in a 3:2 time box for 3 weeks, Delay Pedal, Rabbits in Prison, Asteroid Nears Mars, Tokyo Stormtrooper, Japan's Minister of Defense believes in UFOs

Continue reading "rb_08_jan_14"

permanent link

Friday January 11, 2008 : Artist Spotlight

Story Links: Rocketboom Spotlight: RJD2 - Work It Out directed by Joey Garfield with Ghost Robot.

Continue reading "rb_08_jan_11"

permanent link

Thursday January 10, 2008 : Micronations and Subnormal News

story links: Lake Chargoggagoggmanchauggagogg- chaubunagungamaugg, Krungthepmahanakornamornratanakosinmahintarayutthayamah - adilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit, Principality of Sealand and Order of Malta and the Kingdom of Elleore (via), Robot Bicyclict (via), First 2008 Entry into the Darwin Awards, Gaming Flowchart, Woman struck by lightening survives, Paranormal restraining orders, Tumblr, Rocketboom Tumblr Blog

Continue reading "rb_08_jan_10"

permanent link

Wednesday January 9th, 2008 : Election Coverage

A day in the life of independent coverage of the U.S. Presidential Elections: RB field correspondents Chuck Olsen and Steve Garfield cover the primaries for The Uptake as RB field correspondent Jacob Soboroff promotes election reform with WhyTuesday?

Continue reading "rb_08_jan_09"

permanent link

Tuesday January 8th, 2008 : Elections in Kenya

Story Links: Rocketboom field correspondent Ruud Elmendorp covers the lead-up to the election violence in Kenya.

Continue reading "rb_08_jan_08"

permanent link

Monday January 7, 2008 : Days and Cycles

story links: King Alfonso of Portugal, A woman was spotted yesterday reading today's paper, Solar Cycle #24 begins, Fox Business News Network watched by only 6,300 people per day at any give time (example video), Jay Leno back on TV without his writers, Classic Tootsie Roll Commercial, ROFL-con, Tron Guy, I Can Has Cheeseburger?, Fark, 4chan, Where the Hell is Matt, Homestar Runner, Rocketboom iPhone Webapp, Erik Herz demonstrates Rocketboom streaming online from iPod touch to TV

Continue reading "rb_08_jan_07"

permanent link

Friday January 5th, 2007 : Rocketboom Spotlight

Story Links: Rocketboom Spotlight: New York Airplane Flight by Sam Fuller

Continue reading "rb_08_jan_04"

permanent link

Thurs January 3rd, 2008 : Predictions and Robots for 2008

story links: Game Boy Around the World, The rise and fall of Hello Kitty Hell, Twitter list of prediction lists, Ask Bill Gates at CES, Apple to take over world in 2008, Robert X. Cringely's wackywise predictions, Don't censor me "worst comments on digg" aggregator, Assembly motion tracking bot honored, via,2008 Robot Video Page

Continue reading "rb_08_jan_03"

permanent link

Mon December 31, 2007 - Know Your Meme: Crank That

story links: Know Your Meme, DeAndre Ramone Way aka Soulja Boy Tell'em, Crank That music video, How to Crank That instructional dance video

Continue reading "rb_07_dec_31"

permanent link

Friday Dec. 28, 2007 - Know Your Meme: Tay Zonday

story links: Know Your Meme, Adam Nyerere Bahner a.k.a Tay Zonday, Chocolate Rain, Tay Zonday on Jimmy Kimmel, Chad Darth Tay Zonday Vader , McGruff the Tay Zonday Crime Dog, Vanilla Snow, Cherry Chocolate Rain Dr. Pepper

Continue reading "rb_07_dec_28"

permanent link

Thurs December 27, 2007 - Know Your Meme: Reaction & Response

story links: Know Your Meme, Charlie the Unicorn, Britney Spears on MTV 2007, Chris Crocker Leave Britney Alone reaction video, Seth Green Leave Chris Crocker Alone video, Perez Hilton Leave Me Alone video, Britney Spears impersonator responds to Leave Chris Crocker Alone video, Two girls and one cup reaction videos [Jmoraski8, Kermit, Roots, Grandma]

Continue reading "rb_07_dec_27"

permanent link

Wed Dec 26, 2007 - Know Your Meme: Dramatic Prairie Dog

story links: Know Your Meme, Dramatic Prairie Dog, lolrus, Dramatic Chipmunk vs Dramatic Prairie dog on Google Trends, Japan's Mini Moni on Hello! Morning - original source of the Dramatic Prairie Dog, Drama Prairie Dog on Encyclopedia Dramatica, Collection of videos of Prairie Dog remakes

Continue reading "rb_07_dec_26"

permanent link

Monday December 24, 2007 - Know Your Meme: Technoviking

story links: Know Your Meme, Technoviking parade, Technoviking with subtitles, Technoviking on Michael Jackson's Beat It! (via), Technoviking Cranks Dat ytmnd, Lolcat Technoviking, Vote for Technoviking

Continue reading "rb_07_dec_24"

permanent link

Friday December 21, 2007 - Know Your Meme: LOLCats

story links: Know Your Meme, LOLCats, I can has cheeseburger, Make your own LOLCat Pics, LOLcode, History of according to Anil Dash, LOL reference links

Continue reading "rb_07_dec_21"

permanent link

Thursday, December 20, 2007 - Know your Meme: Natural Parody

story links: Know Your Meme, Miss Teen USA South Carolina answers a question, Miss Teen USA South Carolina answers a question (with subtitles), What's really going on up there?, Miss Teen South Carolina Calls 911, Miss Teen South Carolina in front of Rocketboom map mashup

Continue reading "rb_07_dec_20"

permanent link

Wednesday December 19, 2007 : Know Your Meme - I Like Turtles

story links: Know Your Meme, I Like Turtles, Trained Turtle, Turtles Megamix Music Vid, Floating Turtles Remix, I Like Turtles kid explains why he said I like turtles, Tay Zonday I like Turtles mashup, More videos with Ellie from Rocketboom

permanent link

Tuesday December 18th, 2007 - Know Your Meme: The Rickroll

story links: Rocketboom Holiday Episode Know Your Meme - Rick Roll, #1 BEST VIDEO EVER! CLICK HERE!!, Rick Astley's Never Gonna Give You Up, What the F! bomb, Duckroll, The first Rickroll YTMND, Formal definition of Rickroll & Various extensions and mashups of the Rickroll, Paris Hilton, Britney Spears and Lindsay Lohan perform together in new hit dance single, Failed attempt at force-rickrolling by Carson Daly and the death of the Rickrolling meme

Continue reading "rb_07_dec_18"

permanent link

Monday December 17th, 2007 - Know Your Meme: One Take

story links: Rocketboom Holiday Episode Know Your Meme - One Take, Dafthands, Daft Bodies, The Way Things Go, Ok Go!, Flagpole Sitta Lipdub

Continue reading "rb_07_dec_17"

permanent link

Friday December 14th, 2007 : Changing The Present

Joanne interviews Robert Tolmach of Changing The Present

Continue reading "rb_07_dec_14"

permanent link

Thursday December 13th, 2007 : Horses and Spaceships

story links: Bucketroom mashup (thanks, Ronen!), Animal rights activists call for the end to the NYC Horse and Carriages (image credits: 1, 2, 3, 4), NASA STS-122 space shuttle mission to the ISS rescheduled for January, M-430iA Series Food and Pharmacetutical Robot, J. Craig Venter applies for patent to own synthetic life, Butterfly genes, Google street view, Google maps zoom-way-in close-up, La presión atmosférica, Hare hare yukai zombie dance, Heroboy and Twindreams' human wheelbarroe race, Litroenergy stays on for 12 years, Chris Christmas Rodriguez

Continue reading "rb_07_dec_13"

permanent link

Wednesday January 12, 2007 : Secret Compartment Books

Rocketboom field correspondent Bre Pettis makes a secret compartment book for make.

Continue reading "rb_07_dec_12"

permanent link

Tuesday December 11th, 2007 : Rhizome and the New Museum

story links: Interview with Lauren Cornell on Rhizome.org and new New Museum of New York City

Continue reading "rb_07_dec_11"

permanent link

Monday December 10, 2007 : Day of Days

story links: International Human Rights Day, The 25th anniversary of The Commodore 64, 139th birthday of the first traffic signal, The Beard and Mustache Knitted Face Cap, More cities add LED's to holiday displays, LED X-mas lights for sale online, Vote for Chris Christmas Rodriguez this year to replace Santa, Rocketboom on Tibet, United States only country unwilling to follow Kyoto Protocol, Rudd signs Kyoto Agreement, Investor's Business Daily's Patrick Seitz predicts Apple Macs will gain share, see also Apple Santa, Apple iPhone sales chart, Worldwide iTunes and iPod sales, Apple has $15billion stock pile, Steve Jobs and the Early Years, Weird Shoes, Tay Zonday chatting in Berlin, 17-jointed violin bot, Winston the Waterfountain (via)

Continue reading "rb_07_dec_10"

permanent link

Casual Friday 12/7/2007 : Dogs with more expensive clothes than you

Joanne surveys the winter dogs of New York City.

Continue reading "rb_07_dec_07"

permanent link

Thursday, December 6, 2007: An Introduction to Tibet

story links: tibet, the roof of the world, the himalayas, mount everest, the rest of everest podcast, what is buddhism, potala palace, the tibetan flag, conflict over tibetan independence, tibet's government in exile, the 14th dalai lama of tibet, the 13 previous dalai lamas, rule of the people's republic of china, the destruction of over 6,000 monasteries, riots and arrests reported in tibet, chinese troops travel to tibet using mountain railway, next dalai lama may not be from tibet, tibet's environment under threat from global warming, the official website of the beijing 2008 olympics, free tibet movement | Additional Credits: Co-written by Hal MacDermot

Continue reading "rb_07_dec_06"

permanent link

Wednesday December 5th, 2007 : Mutuku from Nairobi

Story Links: Rocketboom field correspondent Ruud Elmendorp covers Michael Mutuku from de Dandora Nairobi campaigning for city councillor. Extra: Happy Hanukkah Matzah Ball Madness from Washington D.C. Rocketboom field correspondent Andy Carvin.

Continue reading "rb_07_dec_05"

permanent link

Tuesday Dec. 4, 2007 : Garrison Keillor of Prairie Home Companion

Rocketboom interview with Garrison Keillor of Prairie Home Companion

Continue reading "rb_07_dec_04"

permanent link

Monday December 3, 2007 : Clapping Chris Christmas to the Raven

story links: (episode #800)Fastest clapper in the world (video), clap on clap off clapper commercial, PC Clapper, Ascii Generator, This year vote for Chris Christmas Rodriquez to replace Santa, Christmas tree lights to Trans-Siberian Orchestra's "Wizard in Winter, Rockefeller Tree upgraded with L.E.D.s, LED Menorah, The Raven by Edgar Allen Poe

Continue reading "rb_07_dec_03"

permanent link

Casual Friday : CNN YouTube Republican Debate

Republicans at their best answer YouTube user submitted video questions for the CNN YouTube Republican Debate

Continue reading "rb_07_nov_30"

permanent link

Thursday, November 29, 2007: The Underground La Mina Club of Zacatecas, Mexico

story links: rb field correspondent ryan estrada visits la mina club in zacatecas, zacatecas, mexico

Continue reading "rb_07_nov_29"

permanent link

Wednesday November 28, 2007: Miss Koch Youth Group of Nairobi, Kenya

story links: rocketboom field correspondent ruud elmendorp reports on raphael obongo and the miss koch youth group in nairobi, kenya

Continue reading "rb_07_nov_28"

permanent link

Tuesday November 27, 2007: Interview with Tim Westergren of Pandora Radio

story links: joanne interviews tim westergren, founder of pandora radio.

Continue reading "rb_07_nov_27"

permanent link

Monday November 26, 2007 : All You Need Are Hands

story links: ludwig wittgenstein, etiquette in the middle east, use your thumb to point in indonesia, use your chin in honduras, maneki neko, buddhism in a nutshell, hamsa hand, william "dummy" hoy, chinese opera hand gestures, american sign language, swedish sign language | Additional Credits: Co-written by Hal MacDermot

Continue reading "rb_07_nov_26"

permanent link

Wednesday Nov. 21, 2007 : Macy's Thanksgiving Imperial Death March

Whats really going on at the Macy's Thanksgiving Day Parade. See also, The Bluies vs. The Peachies, The Imperial March

Continue reading "rb_07_nov_21"

permanent link

Tuesday November 20, 2007 : News from A - Z

story links: Sumo Akebono vs. bodybuilder Geroege Farah, Ship bow Photoshop, Crayon Physics Deluxe, Decoding your DNA, dfgtuvsdigvofdhdfsohijdfhnidsghfdsiugdghoiidfougdfsghfgyrtdrg.com expired, HD Earthrise and an Earthfall, Procrastination Chart, Battleship, 10Questions, A better Internet by honey bees, Jackson Pollock on fractals, fresh night kite patent application, LOLinator, Ninety percept of IT professionals don't want Vista, Opera of 100 smart rabbits, remote controlled pills, 24 hours of Miss Teen South Carolina, OMG! click here to see the best video in the world!, Space Elevator Videos, Tetris halftime show with Cal Marching band, Happy Birthday Prince Umberto of Bulgaria, Vienna Vegetable Orchestra, Washington D.C. on $85 dollars a day, Sandia’s Z machine for plasmas at 2 billion degrees Kelvin

Continue reading "rb_07_nov_20"

permanent link

Monday November 19, 2007 : Writers of the World

story links: Saturday Night Live kaput?, old guard internet writers, old school internet designers, Jed's Other Poem (Beautiful Underground), Not the Daily Show, Not the Colbert Report (video), Astronomers Journey Halfway Around the World to Study Five-Minute Spectacle, climbing goats in Morocco, Pentaphone Isolation Space For Cell Phone Users, Inflatable lunar habitat in the Antarctic, Writers strike of 1988 led to 9% decline in viewership, Book revival?, A new theory of everything with E8, Standard model of everything, E8 rotation video of 248 dimensions (music), E8 profile archived

Continue reading "rb_07_nov_19"

permanent link

Rocketboom Casual Friday: Rooftop Legends at New Design High School

story links: rocketboom visits rooftop legends at the new design high school in new york city. (music: pianissimo by flatlink)

Continue reading "rb_07_nov_16"

permanent link

Rocketboom Thursday November 15, 2007: Cassini, Animations & Free Magenta

story links: perpetual motion is finally real, revolutionary new telephone technology from 1969,
karnaughcalc
(via apple recent webapps), recent headlines on the recent strikes: writers' strike affecting campaigning for oscars, hollywood writers strike based on fear, theatre conference canceled due To b'way strike, where would money for striking writers come from?, broadway shutdown radiates out, eisner says writers should blame steve jobs, the poet as terrorist?, freemagenta, cassini sounds from saturn, techno viking redux, promesas (thanks, felix!), italian prime minister, 300lb water balloons

Continue reading "rb_07_nov_15"

permanent link

Wednesday, November 14, 2007 Field Report: How To Make a Rubiks Cube out of Dice

story links: rocketboom field correspondent bre pettis (and actiongirl) shows us how to make a rubik's cube out of dice.

Continue reading "rb_07_nov_14"

permanent link

Tuesday, November 13, 2007: The Future of Politics Online with 10Questions.com

story links: joanne explores the present future of politics with andrew rasiej, micah sifry and josh levy of 10Questions.com

Continue reading "rb_07_nov_13"

permanent link

Monday November 12, 2007 : The Smartest People in the World

story links: PetroChina becomes world's first trillion dollar company, Chessboxing, The Radio Hat, Joanne Hello Kitty Hell, Chris Langen smartest person in America (video interview), Take an IQ Test for yourself online now, New Russian spacecraft on the way (video of Sputnik), First HD video from Japan's moon orbiter, wearables charge from breathing ((via ecogeek)), Quarterlife, Birdmoon vultures (thanks, Rosemary!)

Continue reading "rb_07_nov_12"

permanent link

Friday November 9, 2007 : War Dance

Joanne interviews Douglas Egar, executive producer of War Dance

Continue reading "rb_07_nov_09"

permanent link

Thursday November 8, 2007: Field Report - Iraqis Celebrate Winning the 2007 Asia Cup

story links: rb field correspondents alive in baghdad covers the celebration after the iraqis win the 2007 asia cup. (help support alive in baghdad)

Continue reading "rb_07_nov_08"

permanent link

Wednesday November 7, 2007: Field Report - Protecting Hospitals in Iraq

story links: rb field correspondents alive in baghdad profile workers of the facilities protection service at the ibn al-nafees hospital in baghdad, iraq (help support alive in baghdad)

Continue reading "rb_07_nov_07"

permanent link

Tuesday November 06, 2007 : The Business of Social Networks

story links: social network geographical map, Rocketboom on MySpace, Rupert Murdock purchased MySpace for $580 Million, Rocketboom on YouTube, Joanne on Facebook, Microsoft buys Facebook crumb for $240 Million, Facebook worth $15Billion?, Google vs Microsoft over Facebook, Microsoft lands Facebook ad deal, Steve Balmer going crazy over developers, Social Graph problem, Google's Open Social, cookie tracking profile ad sales

Continue reading "rb_07_nov_06"

permanent link

Monday November 5, 2007 : Tokyo Dance Trooper, Diet Coke & Mentos Exclusive, & Moon Echoes

story links: tokyo dance trooper 1 & 2, will don come back?, echoes from the moon, the WGA goes on strike, breaking news in the diet pepsi and mentos meme, the politics of parsing, google open social hacked, facebook valuation, myspace comeback, fictional wwii light transport vehicles

Continue reading "rb_07_nov_05"

permanent link

Casual Friday November 2, 2007 : Bike Ride Through NYC

Joanne goes for a bicycle ride through Manhattan.

Continue reading "rb_07_nov_02"

permanent link

Thursday November 01, 2007: New York City Halloween Parade

2007 Annual New York City Halloween Parade

Continue reading "rb_07_nov_01"

permanent link

Wednesday October 31, 2007 : The Origins of Halloween

Story Links: bonfire, Chinese lanterns, dinner, Stonehenge, Day of the Dead, French graveyard, pentacle, Egypt, Hell, Pope, voodoo, Baron Samedi laughing on train, Baron Semedi commercial, Special Thanks to Abracadabra for generously loaning the costumes to Rocketboom | Additional Credits: Co-written by Hal MacDermot

Continue reading "rb_07_oct_31"

permanent link

Tuesday October, 30, 2007 : Shakespeare Theater

Story Link: Joanne interviews Shakespeare Company Theater Artistic Director Michael Kahn on the new Harmon Center for the Arts theater in Washington D.C. [music by Two Violins

Continue reading "rb_07_oct_30"

permanent link

Monday October 29, 2007 : Evolution of the Species

Story Links: Lungfish, Lungfish thought to see in color, (image 1, image 2), Human race will split into two different species according to Oliver Curry, New York City Zombie Walk, NASA expands International Space Station, iPhone Costume Halloween 2007, Fox News links Al Queda to the California Wildfires?, Turkey Webcam, Best eBay feedback ever

Continue reading "rb_07_oct_29"

permanent link

Casual Friday Oct. 26th, 2007 : Rocketboom Enters 4th Year (Episode #775)

Story Link: Archives.

Continue reading "rb_07_oct_26"

permanent link

Thursday Oct 25, 2007 : 9000 Robot Monster Knitting Drummer Dancers

story links: Robot Monster, B-Movies Archive, Indian Michael Jackson Thriller Chiru, World Record attempt for most simultaneous Michael Jackson Thriller dances, Maker Faire Video Set, The Knitting Drummer, Ron Paul mention on Rocketboom, China in Orbit on way to Moon, No mention of China Moon launch at NASA, Hardees New Breakfast Burrito containing 1g of fat less the US Recommended Daily Allowance, 9000 ytmnd calories, over 9000 the new at least 100?, 4chan, Exoskeleton, Log Rider (thanks, iDrifter), Rosie O'Donnell Videoblog

Continue reading "rb_07_oct_25"

permanent link

Wednesday October 24, 2007 : Is Graffiti Art or Crime?

story links: rocketboom field correspondent juliette powell attends the legal defense fundraiser for graffiti artist 2ESAE at eyebeam in new york city.

Continue reading "rb_07_oct_24"

permanent link

Tuesday October 23, 2007 : This Year in Sports

story links: Liquid Bendy, Log Riding Championship of the World, Ippon Nori is a ride on a log, The Ladder Climb, South Korean Fans, Bogsnorklers, Jump Rope Champions, 2007 French Downhill Championship, Beatbox Battle, 2007 Folding bike Brompton World Championship, Nordic Champion of The Flip, 2007 KNPV Championship, European Haidong Gumdo Sword Battle Championship 2007, Flip-side USA Hip Hop Champions , Jalan Besar Champ Taiwan 2007 Asian Luminous Dragon Dance, Lefteris Sarafis, 2007 HBA flartending Champion of the World, The 2007 Vintage Military Rifle Championship, 2007 Old-Time Piano Championship

Continue reading "rb_07_oct_23"

permanent link

Monday October 22, 2007 : Maker Faire Austin 2007

story links: Rocketboom and Sarah Meyers covers Maker Faire 2007 Austin, Texas (Extra/Extended Video Set)

Continue reading "rb_07_oct_22"

permanent link

Casual Friday October 19, 2007: Joanne's Conscience of Crisis

story links: 'devil-angel 1' created by chris cole and joanne colan

Continue reading "rb_07_oct_19"

permanent link

Thursday October 18, 2007 : The Private War Contract

story links: Blackwater, Representative Waxman on Blackwater, DynCorp, KBR private contractor job listings, Army Pay 2007, Additional figures on security contractors, Council on Foreign Relations, memo to Oversight Committee October 1st 2007 | Additional Credits: Co-written by Hal MacDermot

Continue reading "rb_07_oct_18"

permanent link

Wednesday October 17, 2007 : The Electric Volt Car

Story Links: Rocketboom field correspondent Steve Garfield checks out the Chevy Volt next-generation electric car.

Continue reading "rb_07_oct_17"

permanent link

Tuesday October 16, 2007 : Around America in 2.0

Story Link: Joanne interviews Matthew Danzico of Around America in 2.0 about his free travels across the country.

Continue reading "rb_07_oct_16"

permanent link

Monday October 15, 2007 : Radio Trumpet Vikings & Hiltrons

story links: Radiohead pay-what-you-wish record sales, Star Wars trumpet girl, Allen Telescope Array, Techno Viking with captions, Superman reverse Moon transit, Hitler Banned From iSketch, Myriam Laplante's Lupus in Fabula (via), Planet Hiltron, El Patito Feo -The Ugly Duckling

Continue reading "rb_07_oct_15"

permanent link

Causual Friday October 12, 2007 : Around the Park

story links: William Wegman and Roxy Paine at Shake Shack in Madison Square Park

Continue reading "rb_07_oct_12"

permanent link

Thursday October 11, 2007 : World Champions & Other Stuff

story links: 1582 missing records, 2007 Rubix Cube champion Yu Nakajima, one handed Rubix Cube champion Dan Dzoan, blindfolded Rubix Cube champion Chris Kruger, how to cube blindfolded, wall-mart spread (via), baby moving inside belly videos, Porridge making champion of the world Maria Soep, Hello Kitty Hell Glass Slipper, Jaiku bought by Google, Rocketboom on Jaiku, Rocketboom on Twitter, Rocketboom in Flash, Rocketboom in Closed Caption and multiple languages, Rocketboom on YouTube, Rocketboom for the iPhone, Rocketboom Blog, Motion Abbey, Rocketboom Store, system for destroying intruder astroids, demotivational posters

Continue reading "rb_07_oct_11"

permanent link

Wednesday October 10, 2007 : Motion Analysis

story links: Avatar Man, invisible cloak, motion capture, 3D facial animation with expression detail mapping, color based object tracking, Eyesweb tracking software, motion tracking home test, Tony Hawk motion capture for skateboarding game, motion capture suit, Wayne Rooney captured for EA Sports, Flo control

Continue reading "rb_07_oct_10"

permanent link

Tuesday October 9, 2007 : Kitale Conservancy for Handicapped Animals

story links: Rocketboom field correspondent Ruud Elmendorp covers the Kitale Nature Conservancy for handicapped and genetically mutated animals in Kenya

Continue reading "rb_07_oct_09"

permanent link

Monday October 8, 2007 : First Person Protagonists

story links: First person shooter Avatar Man (via pixelsumo, see also: First Person Shooter by Blake Fall-Conroy), French urban Olympic training, 13-year student Johnny Lechner live cam, Appendix with a purpose, Instant Baby Machine, Human creation of life announcement expected from Craig Venter, Second Earth in the making

Continue reading "rb_07_oct_08"

permanent link

Casual Friday October 5, 2007 : The Business of Fandom

story link: rocketboom nyc field report by davidjr

Continue reading "rb_07_oct_05"

permanent link

Thursday, October 4, 2007 : burbles and bowling and boingboing tv

story links: boingboing tv, the plastic infinite, burble, burble london, wiimbledon on rocketboom, retiree wii bowling tournament, wii bowling championship match, retirement living tv, walter cronkite the comeback kid, transparent frogs, a real invisibility cloak, a fake invisibility cloak, sputnik, nekomimi lisa

Continue reading "rb_07_oct_04"

permanent link

October 14, 2007 : Free Burma

story: Free Burma

Continue reading "rb_07_oct_04a"

permanent link

Wednesday October 3, 2007 : Mellotron

Rocketboom Field Correspondent Bre Pettis on how to make a mellotron

Continue reading "rb_07_oct_03"

permanent link

Tuesday October 2, 2007 : Myanmar / Burma

story links: Myanmar (Burma), UN Human Development reports, Demonstrations of 1988, Aung San Suu Kyi, Monks killed and left in jungle, Country shuts down internet, Jim Carry, using satellite imagery to track atrocities, Facebook group for world-wide action (oct 6), free burma day action for bloggers (oct 4), U.S. Campaign for Burma

Continue reading "rb_07_oct_02"

permanent link

Monday October 1, 2007 : Japan, iPhones, MIT, Rainbows & Iran

story links: Alexander the Great defeats Darius III of Persia in the Battle of Gaugamela, John XIII becomes Pope, Nguyen Hue declares himself emperor of Vietnam, top viewed YouTube videos for today, Naruto Shippuuden, non animated animation, iPhone unlocked and hacked, Apple warning, Legal Rights on unlocking, Apple firmware update, hacked iphones bricked, new SIM cards from AT&T method for brick restoration, Apple Genius' fix phone, Apple Genius' don't fix phone, Gizmodo: Don't Buy, Homeland Security Alert, Firmware Downgrade instructions, Happy again hacked iPhone, Gizmodo slowly cooling off on iPhone revolt, McDonalds restaurants across Manhattan close, photoshop this #1, photoshop this #2, rainbow time lapse, President of Iran at Columbia University, NYC subway cars dumped in sea

Continue reading "rb_07_oct_01"

permanent link

Casual Friday Spetember 28, 2007 : It's Jerry Time

story link: it's jerry time

Continue reading "rb_07_sep_28"

permanent link

Thursday September 27, 2007 : News From the Internet(s)

halo3 images (1, 2, 3), dawn launch, bangkok market train, hair dryer revolver, walking the fish, nerd auction, worshiping the purdue engineering Fountain flash mob, all atari video by golden shower, rocketboom minnesota field correspondent chuck olsen covers digeredoo brain massage, bob dylan video generator, church sign generator, tiny dj's

Continue reading "rb_07_sep_27"

permanent link

September 26, 2007 : The American Vote

story links: rocketboom special field correspondent jacob soboroff of covers the vote from colonial america

Continue reading "rb_07_sep_26"

permanent link

Tuesday September 25, 2007 : Criminal Tribunal of Rwanda

story links: rocketboom field correspondent ruud elmendorp covers the international criminal tribunal of rwanda in tanzania

Continue reading "rb_07_sep_25"

permanent link

Monday September 24, 2007 : Dawn, Pluto, Iran, Blip

story links: muhammad completes hegira from mecca to medina, nasa prepares dawn for destination to astroid belt, pluto off course, orgosolo's ballo sardo sardinien, mayor bloomberg denies trade center access to iranian president, new bubble wrap technology (via), i take a picture of a vending machine every day and I’m very sorry (via), blip.tv (read more about sponsorship details)

Continue reading "rb_07_sep_24"

permanent link

Casual Friday September 21, 2007 : One Web Day

story links: one web day, interview with founder of one web day, one web day wikiboom answer page, rocketboom music mashup by radioscopic

Continue reading "rb_07_sep_21"

permanent link

Rocketboom: lexical ambiguities, astronauts, & bored firefighters

story links: the woman saw the girl with a telescope, young woman old woman illusion, buffalo buffalo buffalo buffalo buffalo buffalo buffalo buffalo, no car day in china, lion-eating poet in the stone den, the latest oldest person in the world, the horse raced past the barn fell, car lifted by firehoses, job listing for astronauts (via slashdot), job listing for astronuts

Continue reading "rb_07_sep_20"

permanent link

Make on Rocketboom: How To Make a Foxhole Radio

story links: rb field correspondent bre pettis from make magazine shows us how to make a foxhole radio, hollywood now with joanne colan on paltalk.com

Continue reading "rb_07_sep_19"

permanent link

Rocketboom: Ice Robots, Endangered Mammals & the McClure Strait

story links: flying polar robot, arctic sea route opens after ice melts, amazing wall animation by blu, humans responsible for climate change, bush or chimp, world conservation union red list, warm dark matter and stars

Continue reading "rb_07_sep_18"

permanent link

Monday Sep. 17, 2007 : Linux, Fair Use, Apple, One Web Day, Memes

story links: happy birthday to linux, the computer and communications industry association, fair use report, apple blocks non-itunes software use with ipod, apple ipod block checksum cracked, rockbox linux ipod firmware, one web day (video interview with founder), one web day wikiboom, obstruction removal, happy birthday boston, know your meme, itschriscrocker's piggyback meme, most discussed videos on youtube of all time

Continue reading "rb_07_sep_17"

permanent link

Casual Friday September 14, 2007 : Burning Man

story links: rb field correspondent juliette powell visits the burning man festival at the black rock desert in nevada. (extended video set)

Continue reading "rb_07_sep_14"

permanent link

Thursday September 13, 2007 : Daily News From the Internet(s)

story links: 8.4 earthquake strikes southern sumatra, britney fan, zombocom, sarah meyers at fashion week, drum pants, transforming clothing, X Prize goes to Moon, harry potter films on top, ice cream machine

Continue reading "rb_07_sep_13"

permanent link

Rocketboom: Longer, Taller, Farther, Odder : September 12, 2007

story links: rb field correspondent stefan sydel sms ;) covers the 2007 ars electronica festival in linz, austria, the tallest lego tower ever built, japanese plan the world's tallest building, the longest list of the longest stuff at the longest domain name at long last dot com, the longest building ever, the longest abbreviation ever, hurricane felix on wikirage, rocketboom on ytmnd, zombocom, seven wonders of the it world, nasa's voyager 1, ibm bgl supercomputer

Continue reading "rb_07_sep_12"

permanent link

Rocketboom : George Bush on September 11, 2001

george bush on september 11th being told the second tower had been hit

Continue reading "rb_07_sep_11"

permanent link

Rocketboom News: Flying Cars to Air Guitars : September 10, 2007

story links: don alonso perez de guzman el bueno, remote control skates, joanne's hollywood now show on pal talk (extended paltalk interview (quicktime, windows media), x-hawk flying car (via), ochi 'dainoji' yosuke world air guitar champion (2006, 2007), cardboard box furniture patterns, related rb episode, iramzayi of miss teen usa

Continue reading "rb_07_sep_10"

permanent link

Casual Friday September 7, 2007 : Soundscape

sound design

Continue reading "rb_07_sep_07"

permanent link

Thursday September 6, 2007 : News From Around The World

story links: cow milking cam from denmark, baby sumo contest in japan, teen arrested for posting youtube of himself speeding in london, hepskukkuu finland ymca remake, rb field correspondent stefan sydel sms ;) checks out splayTV from the reeperbahn, chris jordan's running the numbers, hole on mars (thanks, chris c.!), biggest hole in universe found

Continue reading "rb_07_sep_06"

permanent link

Wednesday September 5, 2007 : Cell Phone Reporting from Africa

story links: rocketboom field correspondent ruud elmendorp covers a cell phone reporter for voices of africa

Continue reading "rb_07_sep_05"

permanent link

Tuesday September 5, 2007 : Memes, Iran, NBC, Mars

story links: know your meme, miss teen usa top video, top youtube videos, george bush in iraq, tony snow on issuing fake news reports, times online lays out 3-day strike plans on iran, daily kos on possible was with iran, john bolton on war with iran, fox news on war with iran, apple on nbc, nbc on apple, translating hulu, jibjab animation staring you, iphone wholesale unlocks, young hacker who broke iphone lock, gphone seems to be real, mars rovers keep on ticking, chevy tahoe

Continue reading "rb_07_sep_04"

permanent link

Rocketboom News : Monday September 3, 2007 : Encore Week Final Entry

story links: godzilla moves to portland and terrorizes cats, inmates in philippines jail get together and dance, asian home dancer, bolywood thriller, unbreakable umbrella, tech news with shelly palmer, around america in 2.0 project, where's the beef commercial (via), justin.tv live casting, how-to thanksgiving lesson, rocketboom hole on mars, rocketboom on the steinhardt gardens, sicko by michael moore

Continue reading "rb_07_sep_01c"

permanent link

Rocketboom News : Sunday September 2, 2007 : Encore Week

story links: baltimore attacked by algerian pirates led by jan janszoon, rocket tyler, 66 bottles of beer on the roof, eternal sunset, mr. lee cat cam, best ways to sleep at work, counting sheep, world record for sleep deprivation, ztohoven prank a czech tv broadcast, amazing balloon creations, flight of the bumblebee for accordion, rocketboom comments get an upgrade, watch rocketboom in facebook

Continue reading "rb_07_sep_01b"

permanent link

Rocketboom on Meteorites : Saturday September 1, 2007 : Encore Week

story links: meteorites, nasa on meteorites

Continue reading "rb_07_sep_01a"

permanent link

Rocketboom on Sderot & Kassams : Friday August 31, 2007 : Encore Week (3 episodes per day)

story links: rocketboom visits sderot israel on the border of the gaza strip, qassam/kassam rockets

Continue reading "rb_07_aug_31c"

permanent link

Rocketboom on Chaos Theory : Friday August 31, 2007 : Encore Week (3 episodes per day)

story links: chaos theory (via), gaston julia, julia set, benoit mandelbrot, madelbrot set, fractals, earthquake predictions chaos, darpa security chaos, artificial intelligence chaos, pathology chaos, cardiology chaos, invader set

Continue reading "rb_07_aug_31b"

permanent link

Rocketboom Earth Day : Friday August 31, 2007 : Encore Week (3 episodes per day)

story links: happy earth day!

Continue reading "rb_07_aug_31a"

permanent link

Rocketboom on Fallacies : Thursday August 30, 2007 : Encore Week (3 episodes per day)

story links: evolution vs. peanut butter, evolution vs. banana, laraque vs ivanans, bush vs. all people, bush standing vs bush standing, don imus vs. black people, geraldo vs. oreilly, mother vs. son, rumsfield vs. evidence, newt vs. spanish people, list of logical fallacies from the art of reason, post hoc, appeal to majority, appeal to force, appeal to authority, appeal to emotion, begging the question, diversion, non sequiter, subjectivism, straw man, false alternative, ad hominem, tu quoque, poisoning the well, appeal to ignorance, complex question

Continue reading "rb_07_aug_30c"

permanent link

Rocketboom: Backwards Motion : Thursday August 30, 2007 : Encore Week (3 episodes per day)

story: backwards through time, music: eclipse solaire by vinc2-exoplanete

Continue reading "rb_07_aug_30b"

permanent link

Presidential Candidate Videos : Thursday August 30, 2007 : Encore Week (3 episodes per day)

story links: brady bunch, andy plesser on election video, john edwards (video), hillary clinton (video), barack obama (video), sam brownback, jeff jarvis on election video, bill richardson (video), richardson cowboy acting video

Continue reading "rb_07_aug_30a"

permanent link

U.S. Congress in Second Life : Wednesday August 29, 2007 : Encore Week (3 episodes per day)

story links: second life capitol hill ushers in 110th congress with congressman george miller | space created and sponsored by clearink and sun microsystems | more capture of event: video by aldon hynes, video by nathan freitas, orchestrated by justin hamilton

Continue reading "rb_07_aug_29c"

permanent link

Danny & Nina : Wednesday August 29, 2007 : Encore Week (3 episodes per day)

story links: vote on where danny and nina should live, ehrensenf, translations

Continue reading "rb_07_aug_29b"

permanent link

Tallest Buildings : Wednesday August 29, 2007 : Encore Week (3 episodes per day)

story links: taipei 101, sears tower 1, 2, comparison, kvly-tv mast, cn tower 1 2, petronius oil platform, center of india, maharishi mahesh yogi, burj dubai

Continue reading "rb_07_aug_29a"

permanent link

tuesday august 28, 2007 : encore week (3 episodes per day)

Musical Type

Continue reading "rb_07_aug_28c"

permanent link

tuesday august 28, 2007 : encore week (3 episodes per day)

Adaptation from the Shining.

Continue reading "rb_07_aug_28b"

permanent link

monday august 27, 2007 : encore week (3 episodes per day)

story links: opentopia, d & d billards, earth moon sculpture, safari vet, brandon fuller, small dog electronics

Continue reading "rb_07_aug_28a"

permanent link

monday august 27, 2007 : encore week (3 episodes per day)

story links: rb field correspondent ruud elmendorp covers a rare press conference held by joseph kony, leader of the lord's resistance army (l.r.a.)

Continue reading "rb_07_aug_27c"

permanent link

monday august 27, 2007 : encore week (3 episodes per day)

story links: learn to tie your shoes in just seconds [director's cut: mov | wmv]

Continue reading "rb_07_aug_27b"

permanent link

monday august 27, 2007 : encore week

story: tiki music and bar casual friday with tiki bar tv

Continue reading "rb_07_aug_27a"

permanent link

friday august 24, 2007 : casual friday

story links: adam quirk and wreck & salvage adapt d.b. johnson's henry hikes to fitchburg

Continue reading "rb_07_aug_24"

permanent link

thursday august 23, 2007 : field report

story links: interview with kent rogowski on his book bears (music)

Continue reading "rb_07_aug_23"

permanent link

wednesday august 22, 2007 : daily

story links: arsebook, disney edits boingboing out of wikipedia, corporation wikipedia edit roundup, cnn home page (screenshot), msnbc home page (screenshot), space shuttle endeavor lands safely, learning to love reenactment of e.t., sri brahmananda sarasvati, new flash version for online video, the great internet sleep over, cell phone quick release holder, jeff jarvis on the new big, keepon dancing, lolcats, artificial life, dramatic chipmunk, nintendo rube goldberg animation, onewebday (where would you be without the internet?), dan perjovschi at the moma (image), quagmire in iraq, rickrolled (video), glacier melt surfing, tay zonday rickrolling, unified theory of everything, monster flying v guitar, who owns what in web 2.0, yasser arafat died of h.i.v?

Continue reading "rb_07_aug_22"

permanent link

tuesday august 21, 2007 : daily

story links: mona lisa, guillaume apollinaire, pablo picasso (the song), vincenzo peruggia, extreme ironing, escape key, watercone, elvis domain name, galactic suites, omfg

Continue reading "rb_07_aug_21"

permanent link

monday auguat 20, 2007 : field report

story links: joanne interviews susan crawford of one web day 2007

Continue reading "rb_07_aug_20"

permanent link

friday august 17, 2007 : casual friday

story links: one night of fire 2007 on the brooklyn bridge in nyc

permanent link

thursday august 16, 2007 : special feature

story links: elvis presley missing for 30 years, elvis sightings, weekly world news on elvis image, elvislives.net website, manager colonel tom parker on elvis (image), elvis impersonator database, elvis gold medallion for bid on ebay, complete album set of 95 33 inch LPs on ebay, louis vuitton pochette rabat handbag elvis collection, elvis presley image in 3 billion year old rock, supercalafragilisticexpialaelvis.com (ebay auction), elvis is everywhere by mojo nixon, ashikaga yoshikatsu

Continue reading "rb_07_aug_16"

permanent link

wednesday august 15, 2007 : field report

story links: rb field correspondent Bre Pettis shows us how to make a ring from a coin.

permanent link

tuesday august 14, 2007 : daily

story links: dick cheney explains why the u.s. should not attack iraq (via), george bush approval ratings reach historical low, karl rove resigns, why did karl rove resign? (more), ron paul, ron paul leads republicans online, vote swapping ruled legal

Continue reading "rb_07_aug_14"

permanent link

monday august 13, 2007 : daily

story links: the polish port of gdynia opens, collection of unusual animals, iphone clone for sale in china (also see the meizu), space shuttle with missing foam docks with the international space station (see mission live on nasa tv), facebook misconfiguration reveals source code, hacking tools now against the law in germany (via), iceland live

Continue reading "rb_07_aug_13"

permanent link

friday august 10, 2007 : casual friday

story links: adam quirk and wreck & salvage adapt ambrose bierce's an occurence at owl creek bridge

Continue reading "rb_07_aug_10"

permanent link

thursday august 9, 2007 : special interview

story link: interview with jibjab's co-founder gregg spiridellis on the new jib-jab starring you

Continue reading "rb_07_aug_09"

permanent link

wednesday august 08, 2007 : field report

story links: rb field correspondent chuck olsen covers the yearlykos convention in chicago, il. extra: additional video coverage at theuptake.org.

Continue reading "rb_07_aug_08"

permanent link

tuesday august 07, 2007 : daily

story links: fastest milktruck, chicago o'hare ufo mystery for narcap (via), moller international's M200x flying saucer, super sky cycle, d.i.y. personal flying machine contest, micro-electromagnetic levitation possible, anti-gravity theories, the inflatable dress and chair

Continue reading "rb_07_aug_07"

permanent link

monday august 06, 2007 : daily

story links: 8 million year old cypress trees found, prometheus the oldest tree ever known, the man with green blood, big sumo wrestler, sumo blog, phoenix takes off for mars, hole on mars, walking may be worse for the environment than driving a car, nyc filming remains somewhat free, house of representatives support warrantless wiretappings, senate withholds wiretapping vote roll call, nyc trash art

Continue reading "rb_07_aug_06"

permanent link

friday august 03, 2007 : casual friday

story links: adam quirk and wreck & salvage adapt franz kafka's metamorphosis

Continue reading "rb_07_aug_03"

permanent link

thursday august 02, 2007 : daily

story links: rb field correspondent stefan seydel/sms ;-) covers shoeboxed, sounds ball, leap frogging tech, public art sports, government sports, trick sports, rocketboom helmet collection, extra: rb field correspondent chuck olsen covers the minneapolis bridge collapse, gallery of collapsed bridges

Continue reading "rb_07_aug_02"

permanent link

wednesday august 01, 2007 : field report

story link: earth pledge foundation

Continue reading "rb_07_aug_01"

permanent link

tuesday july 31, 2007 : daily

story links: pope break dance file, pope benidictus supports evolution (image), oldest fake toe, where does everything come from, world of warcraft cover dance, aquafina tap water from pepsi, britta water filtration, sound pump, rhythm fish

Continue reading "rb_07_jul_31"

permanent link

monday july 30, 2007 : daily

story links: apollo 15, hello kitty dog, the beauty smile trainer, first person stand-up pinball ball, no no's, bbc iplayer requires microsoft os, uk police head cams, motorcycle dog viking helmets, modern helmet styles, foil helmet, hands helmet

Continue reading "rb_07_jul_30"

permanent link

friday july 27, 2007 : casual friday

story links: fruit tree planting foundation, sierra club's forest protection & restoration campaign, forest stewardship council, world wildlife fund on forests, raintree on rain forests

Continue reading "rb_07_jul_27"

permanent link

thursday july 26, 2007 : daily

story links: godzilla moves to portland and terrorizes cats, inmates in philippines jail get together and dance, asian home dancer, bolywood thriller, unbreakable umbrella, tech news with shelly palmer, around america in 2.0 project, where's the beef commercial (via), justin.tv live casting, how-to thanksgiving lesson, rocketboom hole on mars, rocketboom on the steinhardt gardens, sicko by michael moore

Continue reading "rb_07_jul_26"

permanent link

wednesday july 25, 2007 : field report

story links: rb field correspondent ryan estrada reports on monsoon season in mumbai, india

Continue reading "rb_07_jul_25"

permanent link

tuesday july 24, 2007 : special report

story links: joanne and andrew visit the kwik-e-mart on 42nd street in new york city

permanent link

monday july 23, 2007 : daily

story links: you3b, brady bunch 2.0, tractor fight, mortal kombat acapella, welcome back potter, apocalypseoz, crossed lines in india (from steve lambert), will the iphone blend?, long lines for i'm not a plastic bag (1, 2, 3), i'm not a plastic bag on ebay, backwards piano

Continue reading "rb_07_jul_23"

permanent link

friday july 20, 2007 : casual friday

story link: a casual stroll through battery park

Continue reading "rb_07_jul_20"

permanent link

thursday july 19, 2007 : special report

story links: meteorites, nasa on meteorites, links and image attribution

Continue reading "rb_07_jul_19"

permanent link

wednesday july 18, 2007 : daily

story links: rb field correspondent ruud elmendorp reports on the deadly flu strain h5n1 and measures taken for prevention in kenya

Continue reading "rb_07_jul_18"

permanent link

tuesday july 17, 2007 : daily

story links: one in three americans want an iphone, banana guard, sigmund freud head pop, lewis gordon pugh swims in the north pole, youtube doubling and track stacking with piano, didgeridoo, violin, harp, timpani, dog, number nomenclature, eight is enough, 9-volt l.e.d. lamp, making masks as hobby, karate yeller, despotism, sign hacked for godzilla

Continue reading "rb_07_jul_17"

permanent link

monday july 16, 2007 : daily

story links: apollo 11 takes off in 1969 for the first human flight to land on moon, one night of fire in new york city, hello kitty hell, rachmaninoff's prelude by thomas grillo on moog, internet radio still breathing, more thomas grillo on moog, youtube doubler plays two youtube video at once, angry face cookie to good to win, patent for thinking, gadget age destroying memory, daily videos for iphone and the web at apollo pony

Continue reading "rb_07_jul_16"

permanent link

friday july 13, 2007 : casual friday

story link: rocketboom visits jerusalem (music)

Continue reading "rb_07_jul_13"

permanent link

thursday, july 12, 2007 : special report

story: what do you think? (music)

Continue reading "rb_07_jul_12"

permanent link

wednesday, july 11, 2007 : special report

story links: rocketboom visits the borders of israel (day three)

Continue reading "rb_07_jul_11"

permanent link

tuesday, july 10, 2007 : special report

story: rocketboom surveys sections of israel from above

Continue reading "rb_07_jul_10"

permanent link

monday july 9, 2007 : special report

story links: rocketboom visits sderot israel on the border of the gaza strip

Continue reading "rb_07_jul_09"

permanent link

friday july 6, 2007 : casual friday

story: waiting for the train at grand central terminal

Continue reading "rb_07_jul_06"

permanent link

thursday july 5, 2007 : special feature

story links: happy birthday america, photo credits: jeff keen, jeffwilcox, waldo jaquith3, chispita_666, poldavo alex, theogeo, annenh, michael mx5tx, jami dwyer, dsearls, geoff mcKim, upton, southernview, quaziefoto, jp puerta, drierp

Continue reading "rb_07_jul_05"

permanent link

wednesday july 4, 2007 : field report

story links: rocketboom field correspondent andy carvin visits spin alley during the 2008 democratic us presidential debate at howard university

permanent link

tuesday july 3, 2007 : field report

story links: rocketboom african field correspondent ruud elmendorp reports on saving the elephants in kenya's tsavo east national park

permanent link

monday july 2, 2007 : field week

story links: blogference (thanks, yaron!), rb field correspondent and make podcaster bre pettis covers power tools drag racing at the seattle power tool race and derby 2007

Continue reading "rb_07_jul_02"

permanent link

friday june 29, 2007 : casual friday

story: it was a casual friday at the rocketboom studio...

permanent link

thursday june 28, 2007 : field report

story: apple store iphone line

Continue reading "rb_07_jun_28"

permanent link

wednesday june 27, 2007 : field report

story link: wiimbledon

Continue reading "rb_07_jun_27"

permanent link

june 26, 2007

story: save net radio

Continue reading "rb_07_jun_26"

permanent link

monday june 25, 2007 : daily

story links: tesla coil party, tesla coil and cage, displacement (via boingboing), zbigniew rybczynski, everest summit video page, everest summit video vote page, machine tells brain speed, rotating building (thanks tim!), time graph, space shuttle lands at home after two week stint, missing lake, daily updates of episode mashups, ehrensenf, lycanthrop for sale (thanks, hombrelobo!)

Continue reading "rb_07_jun_25"

permanent link

friday june 22, 2007 : casual friday

story: summer day on the water

Continue reading "rb_07_jun_22"

permanent link

thursday june 21, 2007 : daily

story links: supercalifragilisticexpealiphone.com relisted on ebay, iphone domain names on ebay, price is rIght toast sells for $999, cyclops chicken, haunted ouji board, tornado for sale, good luck pen, time travel ring, a cookie from grandma, graveyard dirt, dinner with american idol clay aiken's mom, empty can of budweiser, da vinchi mona lisa brother in law original painting, rocketboom tshirts

Continue reading "rb_07_jun_21"

permanent link

wednesday june 20, 2007 : daily

story links: baltimore attacked by algerian pirates led by jan janszoon, rocket tyler, 66 bottles of beer on the roof, eternal sunset, mr. lee cat cam, best ways to sleep at work, counting sheep, world record for sleep deprivation, ztohoven prank a czech tv broadcast, amazing balloon creations, flight of the bumblebee for accordion, rocketboom comments get an upgrade, watch rocketboom in facebook

Continue reading "rb_07_jun_20"

permanent link

tuesday june 19, 2007 : special report

story links: joanne interviews attendees winners at the 2007 webby awards

permanent link

monday june 18, 2007 : daily

story links: sushi restaurant people watching, jellyfish lake, cheney's office pressing for strike on iran, john cramer studies time travel (via), arcade basketball in taiwan, (thanks, eduardo!), german wallpapering, real human transformers, appleiphonewholesale.com on ebay for $478,000, supercalifragilisticexpialiiphone.com for sale on ebay for $250,000

Continue reading "rb_07_jun_18"

permanent link

friday june 15, 2007 : casual friday

story links: if time was infinite and space was finite everything would repeat

permanent link

thursday june 14, 2007 : field report

story links: oklahoma city national memorial & museum

Continue reading "rb_07_jun_14"

permanent link

wednesday june 13, 2007 : field report

story links: rocketboom african field correspondent ruud elmendorp reports on the camel bookmobile in garissa, kenya

Continue reading "rb_07_jun_13"

permanent link

tuesday june 12, 2007 : daily

story links: chaos theory (via), gaston julia, julia set, benoit mandelbrot, madelbrot set, fractals, earthquake predictions chaos, darpa security chaos, artificial intelligence chaos, pathology chaos, cardiology chaos, invader set

Continue reading "rb_07_jun_12"

permanent link

monday june 11, 2007 : daily

story links: student arrested for holding equal rights for robots sign, troy was sacked and burned in 1184 b.c., neogentronyx, robotic cow tongues and stomach (via boingboing), the great missing balloon pop, governors island jazz dance, monument to smile, wireless electricity

Continue reading "rb_07_jun_11"

permanent link

friday june 8, 2007 : casual friday

story: chair box

Continue reading "rb_07_jun_08"

permanent link

thursday june 8, 2007 : daily

story links: global warming solar shield quick fix?, pirate speak myth (via), is theseus' ship still theseus' ship?, underwater sculpture, the life of a living sculpture, street knitters, the playmobil stopmotion western, chairbot, credit card spoon and fork, wooden cars, total-time zone wrist watch, horn pipe music, bliptv

Continue reading "rb_07_jun_07"

permanent link

wednesday june 6, 2007 : daily

will coghlan and rob millis of political lunch cover this week's 2008 us presidential debates in new hampshire

Continue reading "rb_07_jun_06"

permanent link

tuesday june 5, 2007 : daily

story links: titus besieges jerusalem, elvis debuts hound dog on the milton berle show, robert f kennedy assassinated, do the right sesame street, miniuscule series, a cacophony for meditation, alfonso's breakin' & poppin' book, flying swiss, the roll back container, chinese smartmobbers use mobile phones to protest chemical factory, terabytes of mars pictures released to the public

Continue reading "rb_07_jun_05"

permanent link

monday june 4, 2007 : daily

story links: rocketboom launches new sponsorship model, new rocketboom t-shirts on sale, general lee on ebay, this spartan life, micro air vehicle, sodium accitate art, fun with tesla coils, rofl, lolcats, lolbots

Continue reading "rb_07_jun_04"

permanent link

friday june 01, 2007 : daily

joanne visits the steinhardt gardens in mt. kisco ny

permanent link

thursday may 31, 2007 : daily

google maps 360 photo view, geo commons map mashups, rocketboom photoshop entries, hole on mars, bento challenge, top 10 useless limbs, map of united federation of planets, skim milk cows, aerogel, ferrofluid sculptures, largest kite in the world, kam pictures, bolivian puss caterpillar

Continue reading "rb_07_may_31"

permanent link

wednesday may 30, 2007 : field report

story links: rocketboom african field correspondent ruud elmendorp covers the dandora dump site in suburban nairobi, kenya

permanent link

tuesday may 29, 2007 : daily

story links: hole on mars, star wars mashups, water photography, no permit required for nyc documentary, general lee for auction again, hazard county swap, photoshop entries from monday

permanent link

monday may 28, 2007 : daily

story links: solar eclipse in 585 b.c., san francisco zombie mob 2007 (images), the universe 3 trillion years from now, milky way mashup, rocket pun?, photoshop contest, the iraq rug, bicycle soccer, on demand crossing, the wisdom of obi-wan, wise yoda is, sony's flexible oled screen

Continue reading "rb_07_may_28"

permanent link

friday may 25, 2007 : casual friday

story link: joanne and jimbo wales play scrabble

Continue reading "rb_07_may_25"

permanent link

thursday may 24, 2007 : field report

story links: rb field correspondent chuck olsen enters the mall of america

Continue reading "rb_07_may_24"

permanent link

wednesday may 23, 2007 : field report

story links: ryan estrada investigates monkey business in mumbai, india

permanent link

tuesday may 22, 2007 : special report

story links: maker faire, extended video set in collaboration with gizmodo

Continue reading "rb_07_may_22"

permanent link

monday may 21, 2007 : special report

story links: joanne interviews andrew rasiej, craig newmark, and thomas friedman at the personal democracy forum, extended interview footage

Continue reading "rb_07_may_21"

permanent link

friday may 18th, 2007 : casual friday

story: after hours

Continue reading "rb_07_may_18"

permanent link

thursday may 17, 2007 : daily

story links: flickrvision, umbrella gps slideshow, full body knit, shoe recycleing, underwater golf tournament, carpet skates, 965 model rockets, typovacs, gas mask bath tile, general lee replica on ebay, mind control dj gear (via artifical eyes)

Continue reading "rb_07_may_17"

permanent link

wednesday may 16, 2007 : daily

story links: twittervision, flickrvision, traffic cam google map mashup, university of nebraska mid-american transportation center lab, update on diy weather balloon, personal democracy forum, u.s. defense department restricts access youtube and myspace, strange newark airport singing session, digg censorship?

Continue reading "rb_07_may_16"

permanent link

tuesday may 15, 2007 : daily

story links: rocketboom's kenyatta cheese visits phillip torrone and bre pettis at the etsy lab in preparation for this weekend's make faire

Continue reading "rb_07_may_15"

permanent link

monday may 14, 2007 : daily

story links: bush resigns mistake broadcast on cnn is real, this day on may 14th , new oldest known star, bacteria discovered living in tar pits, jonathan keller picture-a-day art, building with still frames in time, artichoke machine, sleeping bag walking suit, via the cool hunter, rocketboom ytmnd

Continue reading "rb_07_may_14"

permanent link

friday may 11, 2007 : casual friday

story links: it's jerry time

Continue reading "rb_07_may_11"

permanent link

thursday may 10, 2007 : daily

story links: cbs evening news low point, nbc nightly news records low point, alligator eggs, aol password problems, ulam spiral, supplemental shrubbery, smoke ring machine, moon is in at nasa, quilted asbestos gloves, open source cinema, violin bow and metal fencing, foot surfing rocks in yemen, malaria kills bush mashup, john cage on i've got a secret tv, atari pole position, beck's hell yes

Continue reading "rb_07_may_10"

permanent link

wednesday may 09, 2007 : field report

story links: rb field correspondent ruud elmendorp covers computers for schools kenya on e-waste and computer recycling in africa

Continue reading "rb_07_may_09"

permanent link

tuesday may 08, 2007 : daily

story links: ustream, 2001 kottke cam, 1995 xmas cam, opentopia webcams, 6800 pacific ave omaha nebraska, 6800 pacific ave cams with tracking, 6808 pacific ave cam with tracking, university of nebraska mid-american transportation center lab, matc lab cam, matc lab people, just deserts bakery

Continue reading "rb_07_may_08"

permanent link

monday may 07, 2007 : daily

story links: republican presidential contenders who disbelieve evolution, george bush at low point with 28% popularity, cookie monster eats a computer (via), rocketboom translations, 09f911029d74e35bd84156c5635688c0.ws, $40 q-tip for sale on ebay, dukes of hazzard general lee car fetches over 9 million, worst of spider man merchandise, i'm a marvel and i'm a d.c. statement on film productions, wonder woman, cnn to release their debates online under creative commons, make your own shapes in toast, garbage truck living, world wildlife fund global warming report

Continue reading "rb_07_may_07"

permanent link

friday may 5th, 2007 : casual friday

story: music in the park

Continue reading "rb_07_may_04"

permanent link

thursday may 03, 2007 : daily

story links: joao i, lester bookbinder, terms of the 1970s, terms of the 1980s, terms of the 1990s, rep tim ryan opposition to bush bill, street skater dalnas, nasa titan landing data, nasa funky education, michael jackson glove data, balancing can

Continue reading "rb_07_may_03"

permanent link

wednesday may 02, 2007 : field report

story links: circuit bending at the new york city bent festival

Continue reading "rb_07_may_02"

permanent link

tuesday may 1, 2007 : daily

story links: jott speech to text email, mojave desert phone booth project, rocketboom on cell phone time-to-play, 4 leaf clover collection, green water chicago, what if the beatles were irish?, million dollar documentary, watermelon sculpture, wow at voorut

Continue reading "rb_07_may_01"

permanent link

monday april 30, 2007 : daily

story links: george washington takes first oath as president of the united states, history of nbc, general electric to shed nbc, msnbc presedential debate video violation by joe biden via jeff j, hair cut raises up on twitter vokyous via), the shampoo shade, new world-wide rail speed record set by the french, new world-wide coconut orchestra record set by monty python, pi to 100 places on piano, radius man square dancer, space invader pillows (via kotaku), rb air brush kam

Continue reading "rb_07_apr_30"

permanent link

friday april 27, 2007 : casual friday

story links: final times for coney island's astroland, music by kris

Continue reading "rb_07_apr_27"

permanent link

thursday, april 26, 2007 : daily

story links: rocketboom with closed captioning and multiple languages on dotsub free video wiki tool

Continue reading "rb_07_apr_26"

permanent link

wednesday april 25, 2007 : daily

story links: japanese street painters rinpa eshidan ありがとう blog tv!

Continue reading "rb_07_apr_25"

permanent link

tuesday april 24, 2007 : daily

story links: the global incident map, terrorism awareness project, 100 year predictions made in the year 1900, wireframe car sculpture by benedict radcliffe, fatclownmoron re: saerain re: sorrow, monkey bot, table cloth magic, kramer performance breakdown, mike daisey's performance recovery

Continue reading "rb_07_apr_24"

permanent link

monday april 23, 2007 : daily

story links: earth day, bee mystery, einstein bee quote mystery, the kereoke death match 100, hands-free jump rope machine, radio waves used to eavesdrop on contemporary computer monitors, only 244 copies of microsoft vista sold in china, microsoft admits vista failure, scoble on microsoft's loss of double click (image by kk+), bomb scale chart from popular mechanics, emperor constantino with balloon, darth vader balloon [cc photo credits: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13]

Continue reading "rb_07_apr_23"

permanent link

friday april 20, 2007 : daily

story links: happy earth day!

Continue reading "rb_07_apr_20"

permanent link

thursday april 19th, 2007 : daily

story links: rocketboom receives 3 honorable mentions for 2007 webby awards, podcast hotel, bandon-to-youtube update, rocketboom in closed caption and other languages, timothy yue taps with bill bojangles, watching cheese grow, china's yangtze river reaches point of no return (images by kthypryn), the ziggurat game conference (thanks, steed!) , live cam in denmark, man speaks for 6 days and 5 nights, houston we have a problem cam

Continue reading "rb_07_apr_19"

permanent link

wednesday april 18, 2007 : daily

story inks: u.s. spending report for war on terror since 9/11, city projections of teenage mutant ninja turtles, spit art, no-skiing london tube stickers, change in concentration of wealth, price for life at nasa, price for life in iraq, citizen urban armor, karl rove's lost e-mail trove, geek squad caught videotaping woman in shower, why is fabio the spokesperson for geeksquad?, geek squad on the best buy customer, chris pirillo on ustream.tv, michael jackson rages on

Continue reading "rb_07_apr_18"

permanent link

tuesday april 17, 2007 : daily

rb field correspondent bre pettis on the second balloon launch for make

Continue reading "rb_07_apr_17"

permanent link

monday april 16, 2007 : field report

story inks: hans johnson's massai school project in southern kenya by rb field correspondent chuck olsen

Continue reading "rb_07_apr_16"

permanent link

friday april 13, 2007 : casual friday

story links: what do you represent? music (by drew), related (thanks, nick!)

Continue reading "rb_07_apr_13"

permanent link

thursday april 12, 2007 : daily

story links: evolution vs. peanut butter, evolution vs. banana, laraque vs ivanans, bush vs. all people, bush standing vs bush standing, don imus vs. black people, geraldo vs. oreilly, mother vs. son, rumsfield vs. evidence, newt vs. spanish people, list of logical fallacies from the art of reason, post hoc, appeal to majority, appeal to force, appeal to authority, appeal to emotion, begging the question, diversion, non sequiter, subjectivism, straw man, false alternative, ad hominem, tu quoque, poisoning the well, appeal to ignorance, complex question

Continue reading "rb_07_apr_12"

permanent link

wednesday april 11, 2007 : field report

story links: dominic allen of scarab studio covers ian skiller for ripples on the arrival of refugees to his australian farm

Continue reading "rb_07_apr_11"

permanent link

tuesday april 10, 2007 : daily

story links: plexiglass lightning, ice cream headache remix project (mp3), face transformer, 1-800-goog411 free telephone information, more "worst to come" global warming reportia, undersea restaurant, extended home aquarium, acme catapult (via cre.ations), greenland auto gps-bot (video), bagel in CD spindle (via boingboing), personal f-train decor

Continue reading "rb_07_apr_10"

permanent link

monday april 09, 2007 : daily

story links: thailand bans youtube for videos defacing the royal family, the infinite cat project, shot spotter, senster interactive robot (video), rocketboom twitter pro, collection of strange maps, secret soviet plans for removal of north american, navigating a dome screen with the wii (video), king lear

Continue reading "rb_07_apr_09"

permanent link

friday april 6, 2007 : casual friday

story links: what do you represent? created by texas93 and tagged videoblogging week 2007

Continue reading "rb_07_apr_06"

permanent link

thursday april 05, 2007 : daily

story links: million dollar documentary (thanks, scott!), youtube can youtube hear me?, david lynch on product placement, david lynch weather report, homeless signs for toronto (thanks, wareinga!), death-star attack conspiracy theory, new laptop for driving. rudy rucker on mathematics and physics (thanks, david!), surfing waves made by dynamite, its jerry time, nikola tesla documentary, link to your favorite entry for videoblogging2007 week in the comments and vote for tomorrows episode

Continue reading "rb_07_apr_05"

permanent link

wednesday april 04, 2007 : daily

story links: microsoft forms, apollo 6 launches, beatles top charts, videoblogging 2007 week, 8675309, leet speak, poetry vlog, pac man re-enactment, lipstick stencil, multi-touch interface design, star trek flat (thanks john!), broadcasting headset monitor, justin.tv, second life gets flooded by adventure ecology (video), josh wolf freed, mlk (via rx)

Continue reading "rb_07_apr_04"

permanent link

tuesday april 3, 2007 : field report

story links: rb field correspondent ruud elmendorp covers reactions in nairobi to the installation of gps trackers in taxi cabs

Continue reading "rb_07_apr_03"

permanent link

monday april 2, 2007 : field report

story links: joanne interviews nic hill on his upcoming wikidocumentary truth in numbers about jimmy wales and wikipedia

Continue reading "rb_07_apr_02"

permanent link

friday march 30, 2007 : casual friday

around chinatown

Continue reading "rb_07_mar_30"

permanent link

thursday march 29, 2007 : daily

story links: rocketboom on twitter, bbq, discardia, hair cut, brain diseases, cisco 7940g, working, incredible horse stunt, weather, mario brothers line rider, escalator skiing, awkward moments on tape, ordering toner, peanuts, robogeek

Continue reading "rb_07_mar_29"

permanent link

wednesday march 28, 2007 : field report

story links: rb field correspondent josh kinberg on the new york police department's illegal surveillance of his 2004 bikes against bush project (nytimes article)

Continue reading "rb_07_mar_28"

permanent link

tuesday march 27, 2007 : daily

story links: charles, orang utan near extinction, part sheep part human animal (thanks b-man!), philip glass buys a loaf of bread, 10 things about einstein (via fimoculous), atari centepede, brain control patent, modern stonehenge man

Continue reading "rb_07_mar_27"

permanent link

monday march 26, 2007 : daily

story links: interaction bot infranoid project (video), cgi city bot by kaktus, beer run bot, tellmeywadenki, bionic hand, humanoids with muscle, festo muscle (video), mmm food bot (via metafilter), electronic hot dog, saturn rotation, saturn's moon titan, moons rotating around saturn, bw sun flare, limb sun flare, xrt eclispe, oldest chunck of earth's crust, helicopter saw, fast food drive-thru rap

Continue reading "rb_07_mar_26"

permanent link

friday march 23, 2007 : casual friday

story links: projecting forward (thanks, g.f.l!), music

Continue reading "rb_07_mar_23"

permanent link

thursday march 22, 2007 : daily

story links: apple tv, screen distance = content length, rocketboom hd, stupidr, kevin ferdeline search, mario bros stop motion lego, mario bros three trombones (via boingboing), uniwheeling, used incinerator, antique cake crumbs

Continue reading "rb_07_mar_22"

permanent link

wednesday march 21, 2007 : daily

story links: new rb australian field reporter stephen pascoe covers the university of new south wales solar racing team as they prepare for the world solar challenge, music by eric camilleri

Continue reading "rb_07_mar_21"

permanent link

tuesday march 20, 2007 : daily

story links: diy fusion reactor, superman turkey, superman india, 248 dimensions mapped in e8, list of twitter apps (rocketboom on twitter), graffiti research laser pointer writing (video), zero-g experience with stephen hawking ebay auction, r2d2 mailboxes, united for peace protest poster, dog fetches virtual ball, clouded leopard, cuff link lights by nate

Continue reading "rb_07_mar_20"

permanent link

monday march 19, 2007 : daily

story links: twitter, high school student creates fusion reactor, los iniciadios marca de anubis, brook benton's father time, djon trick skate designs, interactive modal table (video), god-tube, nasa mars simulation, accordion hero ii (via waxy), vintage to robot head gallery, twenty short animations, tokyo 1935 in color, lego wii (1, 2, 3, 4), closed captioned rocketboom on dutsub with flash sharing

Continue reading "rb_07_mar_19"

permanent link

thursday march 15, 2007 : daily

story links: ides of march, rocketboom website upgrades, ransom, astor place square, deleted youtube videos, in search of a time machine, time dilation, gravitational shifts, reverse transits, dollar time

Continue reading "rb_07_mar_15"

permanent link

wednesday march 14, 2007 : interview

story links: rb field correspondent chuck olsen interviews miles beckett and greg goodfried, the creators of lonelygirl15

Continue reading "rb_07_mar_14"

permanent link

tuesday march 13, 2007 : interview

story links and votes: rb field correspondents andy carvin and chuck olsen interview dan rather at sxsw

Continue reading "rb_07_mar_13"

permanent link

thursday march 08, 2007 : daily

story links: **monday episode 3/12 on hold for site upgrade - stand by for awesome interviews this week including the producers of lonleygirl15 & dan rather | meh, star trek apartment leads to bankruptcy, motorized desk chair, big wheel easter in san francisco, bowling people, two snouted pig, omelette mouse, sushi dance

Continue reading "rb_07_mar_08"

permanent link

wednesday march 07, 2007 : daily

story links: south by southwest interactive conference with rocketboom, jetset (smashface), ask-a-ninja, revision3 and ryan is hungy (podtech), barcamp austin, official sxswi austin party with 30 boxes and satisfaction, politics online conference, von conference (mapping with smoke), podcamp nyc, scooter libby convicted of a lying and cheating, rhino cam (thanks, paul!), human animal experiments in the u.k., bob dylan with cat and the hat (thanks, ronen!), egyptian camel people ragge

Continue reading "rb_07_mar_07"

permanent link

tuesday march 06, 2007 : field report

story links: rb field correspondent bre pettis, prepares for space

Continue reading "rb_07_mar_06"

permanent link

monday march 5, 2007 : daily

**tuesday episode coming today at 12:30pm e.s.t | story links: ransom notes, wreck and salvage (featured episode), ebay ad auction, rocketboom ad creation (example), endangered white rhinos (images), bee c.c.d., sleep awareness week, possible new ocean under asia, 2001 space oddyssey, lunar eclipse, nasa transit moon video, ufo moon transit video

permanent link

friday march 02, 2007

story: vimeo 163464

Continue reading "rb_07_mar_02"

permanent link

thursday march 01, 2007 : field report

story links: rb field correspondent milt lee covers kili radio station in pine ridge

Continue reading "rb_07_mar_01"

permanent link

wednesday, february 28, 2007 : daily

story links: dord, dna to music sequencer (audio), website to dna representation, brain therapy patent, elastic shoe patent, 867-5309's

Continue reading "rb_07_feb_28"

permanent link

tuesday february 27, 2007 : daily

story links: sea animal findings in melting ice caps, painted animals, cross breed hybrid animals, beer launching fridge animal, piano playing cat, astronauts that go animal in space, nasa procedure for astronauts that go animal

Continue reading "rb_07_feb_27"

permanent link

monday february 26, 2007 : daily

story links: giant sinkhole on google maps, fort worth texas sinkhole, steam powered robot (video) via boingboing, terrorists hit second life, second life liberation army, u.s. government forbids sale of domain names to terrorists, finding jesus, japan launches spy satellite, horizon's probe to send back new pictures of jupiter, tree stumps upholstering

Continue reading "rb_07_feb_26"

permanent link

saturday february 24, 2007 : special release

story links: nyc pillow fight [preview interview, last year's rb coverage]

permanent link

friday february 23, 2007 : casual friday

story links: nyc pillow fight preview interview with lori and kevin of newmindspace [full pillow fight coming on saturday] (last year's rb coverage)

Continue reading "rb_07_feb_23"

permanent link

thursday february 22, 2007 : field report

story links: interview with bunker roy of barefoot college (thanks, andrew!)

Continue reading "rb_07_feb_22"

permanent link

wednesday february 21, 2007 : field report

story links: rb field correspondent bre pettis engages in egg dropping for make

Continue reading "rb_07_feb_21"

permanent link

tuesday february 20, 2007 : daily

story links: baghdad market bombings , pakistan train bombings, lebanon bus bombings, terrorist kidnappers tried in italy, italians march in protest u.s. base, 14 billion text messages expected in china, eliminate greenhouse gasses and win $25million, australian bank issues cat credit, norway builds a doomsday vault on the north pole, toronto's environmentally sound office towers, complex japanese orgami with on sheet of paper, street art in south africa, french musician in lisbon, indian thriller

Continue reading "rb_07_feb_20"

permanent link

monday february 19, 2007 : daily

story links: demographics study results [full report] (thanks, rob!), rocketboom interview on american microphone, humvee driving in iraq, volkswagen jumper ad, south korean computer fashion show, plain pink purse, send in your ideas for story links

Continue reading "rb_07_feb_19"

permanent link

friday february 16, 2007 : casual friday

casual friday

Continue reading "rb_07_feb_16"

permanent link

thursday february 15, 2007 : field report

story links: american international toy fair 2007, k'nex, me2, myachi, robotkits, freehand yo-yo, levitating car, rubix revolution, emerson karaoke, scribble mats, my beating heart, all-season sled

Continue reading "rb_07_feb_15"

permanent link

wednesday february 14, 2007 : valentine's day

story: happy valentines day | music: nocturne op post c# by frederic chopin

permanent link

tuesday february 13, 2007 : daily

story links: mate choice copying, heart attack faking, your own romance novel, couple found in historic embrace, studded earphones, mute, will blend valentine gifts, brokeback star trek

Continue reading "rb_07_feb_13"

permanent link

monday february 12, 2007 : daily

story links: dr.seuss literature class (thanks, roger!), interactive bar table display, inkless printer, banning ipod oblivion, longest domain name, anti-scientologist keith henson in jail (thanks, david!), wi-fi on the mesh, guidance system shoes, ipod lock, beware of milk from udder, giant sea boats, worst tv fight ever (with captain kirk)

permanent link

friday february 9, 2007 : casual friday

story: backwards through time | music: eclipse solaire by vinc2-exoplanete

Continue reading "rb_07_feb_09"

permanent link

thursday february 08, 2007 : daily

story links: kite dance (thanks, jeff!), largest machinima dance, worlds fastest drummer (thanks, tamarah), fast typer, google maps aid war in iraq (thanks, stephane!), google maps aid discovery of rainbow unicorn, daily monster (thanks, leighsah!), giant slug, pcb puppet (thanks, gijs!)

Continue reading "rb_07_feb_08"

permanent link

wednesday february 07, 2007 : field report

story links: rb field correspondent steve garfield covers the new england belt sanders association's winter nationals | extra: audience demographic survey

Continue reading "rb_07_feb_07"

permanent link

tuesday february 06, 2007 : daily

story links: plans to outlaw incandescent lightbulbs, global warming irrefutably linked to human activity, global warming to hit the poor the worst, climate dread, high amount of pack ice drifting in icelandic waters (image), low-toxic folding chair, skin bags, catfish grabbin, unsolved problems, stuff on my cat revisited | extra: *audience demographic survey

Continue reading "rb_07_feb_06"

permanent link

monday february 05, 2007 : daily

story links: rocketboom is not on federated media network, sponsor or advertise on rocketboom, *rocketboom audience survey, graffiti research lab (recent rocketboom video), mooninites (news video), prize for fake websites, art student places boxes of fear in nyc subway circa 2002, megatronics will tennis, replica of boston scare mooninites for sale on ebay, side by side sunset cameras, life-size paper boat (video)

Continue reading "rb_07_feb_05"

permanent link

friday, february 2, 2007 : casual friday

story links: a new york fairy tale, music by au lit les momes

Continue reading "rb_07_feb_02"

permanent link

thursday february 1, 2007 : daily

story links: edward iii crowned king of england, teenager counter sues recording industry, underbed tv lift, scooter libby trial coverage (thanks, kevin l!), speedometer videos, give design suggestions for nyc dwellers, ding hai effect, weird local tv commercials, le grand content

Continue reading "rb_07_feb_01"

permanent link

wednesday january 31, 2007 : field report

story link: rb field correspondent ruud elmendorp covers clashes at the nairobi mathare slum

Continue reading "rb_07_jan_31"

permanent link

tuesday january 30, 2007 : daily

story links: patient fixes hospital machine, every n.e.s. game ever on ebay, ray harryhausen (creature list, little miss muffet), current tv (screen shot), phillip torrone, shocking alarm clock, bacon cooking alarm clock, retro gaming light gun alarmclock hack, clocky alarm clock website

permanent link

monday january 29, 2007 : daily

story links: intel announces major processor upgrade using hafnium instead of silicon, amd and ibm announces major processor upgrade using hafnium instead of silicon, gemotion 3d projection screen (thanks, christian d.!), digital monoculture in south korea, line rider urban run, painting with maggots (thanks, brian m.!), rb field correspondent andy carvin covers united for peace iraqi war demonstration (full video) | extra: joanne on cnn's reliable sources (video, transcript)

Continue reading "rb_07_jan_29"

permanent link

friday january 26, 2007 : casual friday

story: casual friday in the subway with the telephone camera

Continue reading "rb_07_jan_26"

permanent link

thursday january 25, 2007 : field report

story links: graffiti research lab, eyebeam and the anti-advertising agency on nyc's graffiti problem inspired by jo lee's abstractor tv, original video by steve lambert, music by ratatat (thanks kenyatta!)

Continue reading "rb_07_jan_25"

permanent link

wednesday january 24, 2007 : field report

story links: on the grand central terminal ceiling (on flickr, on youtube), nokia n93

Continue reading "rb_07_jan_24"

permanent link

tuesday january 23, 2007 : special feature

story links: brady bunch, andy plesser on election video, john edwards (video), hillary clinton (video), barack obama (video), sam brownback, jeff jarvis on election video, bill richardson (video), richardson cowboy acting video

Continue reading "rb_07_jan_23"

permanent link

monday january 22, 2007 : daily

story links: international bag day, trondheim's trampe bicycle lift (thanks, ariel!), horizontal bungie jumping, art gallery ping pong, international space station status report on experimentation and docking, refrigerator webcam in japan (response), frank lloyd wright home rendered in half life (full res), silo missle luxury home with runway, plant krypton, hilary clinton running for president, obama barack running for president, john edwards running for president

Continue reading "rb_07_jan_22"

permanent link

friday january 19, 2007 : daily

story: paper or plastic

Continue reading "rb_07_jan_19"

permanent link

thursday january 18, 2007 : field report

story links: doug aitken and creative time's sleepwalkers at the moma | music: april by jacob cooper

Continue reading "rb_07_jan_18"

permanent link

wednesday january 17, 2007 : special feature

story links: world population clock, china population, china imports western culture [1, 2, 3, 4], western culture does not import much chinese culture, david weinberger on china's effect on the internet, drew on internet's effect on china, world-wide internet users statistics, china tops 20 million bloggers, top duplicate comments from digg for 2006, digg cliche comment generator, top searches in china

Continue reading "rb_07_jan_17"

permanent link

tuesday january 16, 2007 : field report

story links: rb field correspondents bre pettis (for make) and steve garfield build a webcam bird feeder (extended tutorial)

Continue reading "rb_07_jan_16"

permanent link

monday january 15, 2007 : mlk day

story links: rb video mashup (thanks, raymond kristiansen!), martin luther king day (video), comet mcnaught, spitzer telescope spots first glow, world champion freehand drawer, mythical cycloptic flying sea monster, engadget reports 10-million page views during the day apple release day, apple iphone name infringment unlikely, benjamin heckendorns old school game hacks, iphone interface fun on wIndows mobile phones, iphony for palm, iphone - the roach motel business model, you don't need to lock us in, inside the iphone with 3g arm osx and 3rd party ware, bill gates keynote tag cloud, the flux 2007 ipod festival, computer game scores in the guiness book of world records, reg kehoe & his marimba queens (video)

Continue reading "rb_07_jan_15"

permanent link

friday january 12, 2007 : very casual friday

story: fun with archives

Continue reading "rb_07_jan_12"

permanent link

thursday january 11, 2007 : special report

story links: c.e.s. vs. macworld thanks to enric(video) and jadonnelly(video) and ronen(intro mashup), music by drew

Continue reading "rb_07_jan_11"

permanent link

wednesday january 10, 2007 : field report

story links: ian savage covers ice sculpting by ice sculpture designs, music by ameranouche

Continue reading "rb_07_jan_10"

permanent link

tuesday january 09, 2007 : daily

story links: nyc smelled, bird deaths shut down downtown austin, dick cheney goes hunting again, 100 billion for new nuclear warheads, florescent green pigs, video on germs, german inventions, medication for dog obesity, in-shell vaccine for chick disease, helga (thanks, robbie!) | music: neos bop by brian mcrae, hymn of the u.s. marshals by goose creek bands

Continue reading "rb_07_jan_09"

permanent link

monday january 8, 2007 : daily

story links: boom mashup (thanks, ronen!), daily lit, peekvid tv and movies online, mindstorms lego car factory, six degrees of wikipedia, first look at possible iphone, macworld expo, bill gates keynote at c.e.s. (thanks, edelman!), the ordinary adventures of tomas, joanne to interview michael apted (thanks, movielink!)

Continue reading "rb_07_jan_08"

permanent link

friday january 5, 2007 : virtual friday

story links: second life capitol hill ushers in 110th congress with congressman george miller | space created and sponsored by clearink and sun microsystems | more capture of event: video by aldon hynes, video by nathan freitas

Continue reading "rb_07_jan_05"

permanent link

thursday january 04, 2007 : daily

story links: itv, macworld expo, social politics, hybrid assistive limb 5, this spartan life, jimbo van gogh, capitol hill in second life, rocketboom in closed caption and translations (example), send in your stories

Continue reading "rb_07_jan_04"

permanent link

friday december 29, 2006 : casual friday

story: new year's resolutions

Continue reading "rb_06_dec_29"

permanent link

thursday december 28, 2006 : special interview

story link: joanne interviews john edwards in new orleans on run for presidency

Continue reading "rb_06_dec_28"

permanent link

wednesday december 27, 2006 : special feature

story links: rocketboom video of john edwards announcing intentions to run for president via youtube.

Continue reading "rb_06_dec_27"

permanent link

tuesday december 26, 2006 : interview

story links: holiday interview with creative director of barnys department stores simon doonan on his andy warhol inspired window display | music: man it's christmas by jimmie bratcher

Continue reading "rb_06_dec_26"

permanent link

monday december 25, 2006 : holiday

story links: merry christmas ipod fire place (small, wide, large, youtube)

Continue reading "rb_06_dec_25"

permanent link

friday december 22, 2006 : daily

story links happy holidays from rocketboom zadi diaz, chuck olsen, milt lee, graham walker, steve garfield, bre pettis, stefan m. seydel/sms ;-), andy carvin | music: away in a manger by m. ajero, deck the halls/we wish you a merry xmas by doug Boldt

Continue reading "rb_06_dec_22"

permanent link

thursday december 21, 2006 : daily

story links: boingboing year-end video post recap (rss feed), plane repair with duct tape, mobile car shreder, moscow in 1908, tracking santa, truth and method by hans-greorg gadamer, al-qaeda hints at talks with u.s., limited inc. by jacques derrida, steve jobs goes boom, crowded japanese subway, driving in india | translate this episode

Continue reading "rb_06_dec_21"

permanent link

wednesday december 20, 2006 : daily

story links: u.s. year end bank statement (treasury report), bush requests more troops for losing war in iraq, dow jones at record high, suborbital jets for future express flights, brain-controlled robots (electroencephalography), remote spy rc car, air drumming (thanks, pete!) | translate this episode

Continue reading "rb_06_dec_20"

permanent link

tuesday december 19, 2006 : field report

story links: nyu interactive telecommunications biannual graduate showcase, professor marianne petit, botanicalls, people in jars, personal range finder, the human race, muttering hat, futureTV (labeld infortv), vlogbot (labeled futuretv), network performance shoes, music by broken nes, all projects

Continue reading "rb_06_dec_19"

permanent link

monday december 18, 2006 : daily

story links: kishkish lie detector (via), robosapien v2, flamosapien, samsungs machine gun, books without network errors ad, satan book of hell on ebay, atomic energy lab, call from katrin at ehrensenf concerning danny and nina move to denver (not plano), dotsub rocketboom translated into to french, german, slovak, spanish, italian, chinese and croatian (also see ehrensenf in english), help translate today's episode (more info)

Continue reading "rb_06_dec_18"

permanent link

friday december 15, 2006 : casual friday

story links: candy cane wreath notes, vote plano! (happy holidays!)

Continue reading "rb_06_dec_15"

permanent link

thursday december 14, 2006 : daily

story links: vote on where danny and nina should live, ehrensenf, translations | audience submitted links (add yours & your favorites for friday)

Continue reading "rb_06_dec_14"

permanent link

wednesday december 13, 2006 : daily

wii have a problem (thanks, adam!), wii controller to lightsaber, joanne trains with the force, usb missile launcher, send us your links and we'll link to you, the solar death ray (thanks, tim!), vote on t-shirt finalists, story on our vloggie, gadanskst, timmy tap, piglatin searlfearch

Continue reading "rb_06_dec_13"

permanent link

december 12, 2006 : daily

story links: rb field correspondent steve garfield interviews the boston typewriter orchestra

Continue reading "rb_06_dec_12"

permanent link

december 11, 2006 : daily

story links: nasa launch, water on mars (video), iepex pipe organ, parallel parking device (ppd), rocketboom second life player, archie mcphee catalog | music: (1,2,3)

Continue reading "rb_06_dec_11"

permanent link

friday december 08, 2006 : friday field report

story links: mechanical sculptor steve gerberich, miles davis video game music by tyler riggs

Continue reading "rb_06_dec_08"

permanent link

thursday december 07, 2006 : field report

story inks: rb field correspondent bre pettis puts together a shovercraft for make

Continue reading "rb_06_dec_07"

permanent link

wednesday december 06, 2006 : special feature

story links: france 24, carl jan konigel - netherlands, emeka okafor - usa (s. africa), gilles klein - france, giuseppe granieri - italy, juan valera - spain, loic le meur - france, luca conti - italy, roba assi - jordan, robert basic - germany, tristan nitot (firefox market share), telemann duet in b flat by two violins | extra: rocking out the seine video

Continue reading "rb_06_dec_06"

permanent link

tuesday december 05, 2006 : daily

story links: paternoster (thanks, james!), mission stairs, skigliding on the eiger by acro-base (video), jean-yves blondeau buggy rollin (video), make a little move on the dance floor by goovisions

Continue reading "rb_06_dec_05"

permanent link

monday december 04, 2006 : daily

story links: taipei 101, sears tower 1, 2, comparison, kvly-tv mast, cn tower 1
2, petronius oil platform, center of india, maharishi mahesh yogi, burj dubai

Continue reading "rb_06_dec_04"

permanent link

friday december 01, 2006 : casual friday

story links: trade up continued (thanks chiossone and spa treats), part 1, part 2, music: paganini variations by harian glotzer

Continue reading "rb_06_dec_01"

permanent link

november 30, 2006 : special interview

story links: phillip torrone on make's open source gift guide, open source x0xb0x synthesizer with sequencer, rotary cell phone, open source chumley squeezable wi-fi bean-bag computer, minty boost usb charger kit, electronic game kit, daisy mp3 player kit, xgamestation pico edition 2.0, make controller kit (video) make subscription discount for rb audience

Continue reading "rb_06_nov_30"

permanent link

wednesday november 29, 2006 : special interview

story links: joanne interviews peter rojas of engadget at a samsung mobile monday | music: bach prelude suite #1 by cello journey

Continue reading "rb_06_nov_29"

permanent link

tuesday november 28, 2006 : field report

rb field correspondent chuck olsen of mnstories covers interactive toy sculpture artist anastasia ward

Continue reading "rb_06_nov_28"

permanent link

monday november 27, 2006 : daily

story links: zune is a failure, odds of dying, super heros growing old (via), rb field correspondent steve garfield interviews jay rosen on new assignment.net (extended interview), marcy's imperial march and the bluies(quicktime) vs. the peachies(quicktime), water injected turbine, vote on tshirt designs, rocketboom goes to paris, france24

Continue reading "rb_06_nov_27"

permanent link

friday november 24, 2006 : casual friday

story links: macy's thanksgiving day parade, imperial march

Continue reading "rb_06_nov_24"

permanent link

thursday november 23, 2006 : happy thanksgiving!

story links: happy thanksgiving new york city rescue mission, under the overpass

Continue reading "rb_06_nov_23"

permanent link

wednesday november 21, 2006 : special interview

story links: interview with david blaine suspended inside a gyroscope

Continue reading "rb_06_nov_22"

permanent link

tuesday november 21, 2006 : special report

story links: rb field correspondent ruud elmendorp covers somali refugees currently stranded by floods

Continue reading "rb_06_nov_21"

permanent link

monday november 20, 2006 : daily

story links: ps3 lines (thanks, dave!), ps3 ebay auction realtime footage, smash my ps3, where the opposite side of the earth is, series of skating mannequins (via), continuous electronic beam accelerator facility, infiltration magazine, china unblocks wikipedia, yoqoo

Continue reading "rb_06_nov_20"

permanent link

friday november 17, 2006 : casual friday

musical type

Continue reading "rb_06_nov_17"

permanent link

thursday november 16, 2006 : field report

story links: joanne visits huong ngo's pop-up studio, music by evan tate (thanks, kenyatta!)

Continue reading "rb_06_nov_16"

permanent link

wednesday, november 15, 2006 : field report

story links: rb los angeles field correspondent zadi diaz interviews daniel james on painted shoes

Continue reading "rb_06_nov_15"

permanent link

tuesday november 14th, 2006 : daily

story links: czechoslovakia became a republic, the communist party of spain day, 90377 sedna discovered, louis nicolas vauquelin passes away, the perfect face for comedy?, ricky gervais, maurice of nassau prince of orange and yanni, collective standards of photo beauty, msie windows simulation, diet coke and mentos round 2, weather in germany, iraq?

Continue reading "rb_06_nov_14"

permanent link

monday november 13, 2006 : daily

story links: sixtymins ytmnd, lasse gjertsen on drums and piano, jetset, brandon's pitch, the mobile mini circus for children in afghanistan (thanks, berit & david!), rocketboom hi-def on movedigital, rocketboom hi-def on dovetail, last call for rocketboom t-shirts, ebay auction for vloggie, 2 gymnasts with light-saber dance

Continue reading "rb_06_nov_13"

permanent link

friday november 10, 2006 : casual friday

story links: line rider, line riders anonymous, music: tank! by yoko kanno and the seatbelts

Continue reading "rb_06_nov_10"

permanent link

thursday november 9, 2006 : breaking

democrats gain control of house, democrats gain control of senate, democrats gain control of donald rumsfeld, 3d wiki kitchen, eric conveys an emotion wearable home theather, santorum concession (1, 2), music: goose creek bands

Continue reading "rb_06_nov_09"

permanent link

wednesday november 8, 2006 : field report

story links: steven sacks of bitforms gallery features michael najjar (music: paganini variations by harley glotzer)

Continue reading "rb_06_nov_08"

permanent link

tuesday november 7, 2006 : daily

story links: command n, geek brief, steve garfield, tikibar, i make things, channel federator, captain humphreys, viviendo con fallas, wine library t.v., 88slide, ehrensenf, (music by devin anderson), rb awards ebay auction page, podtech (photos 1,2,3), internet bench in gdansk, set of deceptive images, impressive images of the universe, london ipod flashmob, line rider video homage (thanks, eddie!), line riders anonomous, collaborative letters toy, go vote in u.s. (or get someone else to!)

Continue reading "rb_06_nov_07"

permanent link

monday november 6, 2006 : daily

story links: the vloggies full list of winners, vloggie video, vloggie images (thanks, jonny!) alive in baghdad (rb interview), jetset show (yea zadi!), minnesota stories (yea chuck!), travelvlog (yea graham!), get your own vloggie ebay auction, design a rocketboom tshirt, happy birthday to matthew w.

Continue reading "rb_06_nov_06"

permanent link

friday november 3, 2006 : casual friday

story links: dale chihuly exhibition at the ny botanical gardens

Continue reading "rb_06_nov_03"

permanent link

thursday november 2, 2006 : daily

story links: reddit acquired (thanks leron!), pac man pie graph, rb field correspondent ruud elmendorp wins international vj award for work on joseph kony, how to tell you have browser worms (thanks, john r.!), webcam input (thanks, joel, g.!), submit your t-shirt designs, rb field correspondent bre pettis' potato shooter tutorial for make, line rider (video)

Continue reading "rb_06_nov_02"

permanent link

wednesday november 1, 2006 : special feature

story: nyc halloween parade

Continue reading "rb_06_nov_01"

permanent link

tuesday october 31, 2006 : special feature

halloween

Continue reading "rb_06_oct_31"

permanent link

monday october 30, 2006 : daily

story links: reddit, how to create a bottomless pit, not really so scary tshirts, the worst halloween costumes of all time, really the worst halloween costumes of all time, dog costumes, ipod costume, single attack kills 300 us troops and cia and 100+ iraqis, pumpkin computer, virtual hologram effect with t.v., more reddit/rb halloween links

Continue reading "rb_06_oct_30"

permanent link

friday october 27, 2006 : casual friday

story links: interview with a pumpkin, conceived by joanne, animated by ian savage, written, animated, and sculpted by joe vena, filmed at the children’s museum of the arts | extras [mov|wmv], out takes [mov|wmv]: hannah bos, oliver butler, and paul thureen of the debate society, process | add to the halloween link roundup

Continue reading "rb_06_oct_27"

permanent link

thursday october 26, 2006 : daily

story links: colorful horse jockey uniforms, ultra transformer, diver man, jetpack man, inflicting pool by dj flack, no vegemite ban [also] (thanks jennie and adrian!), cylon pumpkin (video), eye smoke man, wearable kinetic sculptures, extreme drive through ordering

Continue reading "rb_06_oct_26"

permanent link

wednesday october 25, 2006 : field report

story link: rb field correspondent ruud elmendorp reports on the recent mobile phone revolution in kenya

Continue reading "rb_06_oct_25"

permanent link

tuesday october 24, 2006 : daily

story links: space elevator games (steve d!), iran is limiting download speeds to 128kbs, america bans the importation of vegemite from australia, oj simpson book rumor said to not be true, suicide robot (video, search), cbgbs, ratio of content to ads on news sites

Continue reading "rb_06_oct_24"

permanent link

monday october 23, 2006 : field report

story links: flash games at atella artois, black raspberry beer, create your own beer, make your own beer label, pirates, smuttynose, and capt. blackbeard!, the beer institute, beer reviews

Continue reading "rb_06_oct_23"

permanent link

friday october 20, 2006 : casual friday

story: making mood music with richard mannoia and rachel shapiro of the mish mash music company

Continue reading "rb_06_oct_20"

permanent link

thursday october 19, 2006 : special feature

story links: rocketboom episode #501, scene by ronen, scene by b-man, scene by aaaaAAACHOOoooo, scene by steve garfield, scene by aaaaAAACHOOoooo, scene by aaaaAAACHOOoooo, scene by fred, scene by aaaaAAACHOOoooo, scene by leron

Continue reading "rb_06_oct_19"

permanent link

wednesday, october 18, 2006 : field report

story links: fragrance week, firmenich sugar lounge, le labo, music: cafe concert by georges gasquy

Continue reading "rb_06_oct_18"

permanent link

tuesday october 17, 2006 : daily

story links: waterball, widescreen ipod, flash earth mapping, body bean bag, scarry drill (thanks, ted!), sonic body pong (via)

Continue reading "rb_06_oct_17"

permanent link

monday october 16, 2006 : daily

story links: sanctions against north korea underway, urban camouflage, voting machine hacks (more), cbgb's closes (thanks, gordon b.), paper trade, 60 vacuum cleaners, international space station cross-lunar transit photos

Continue reading "rb_06_oct_16"

permanent link

friday october 13th, 2006 : casual friday

story links:interview with kess quinn (aka versu richelieu) and reuben steiger with millions of us on a live 72 hours installation build-a-thon called live withouit bounderies for intel, music: reception is suspected | sponsorship: call2recycle rechargeable battery recycling corporation

Continue reading "rb_06_oct_13"

permanent link

thursday october 12, 2006 : daily

story links: rb field correspondent ruud elmendorp covers local opinion regarding the ongoing l.r.a. talks [related], joanne interviews john edwards on recent trip to uganda [related] | sponsorship: call2recycle rechargeable battery recycling corporation

Continue reading "rb_06_oct_12"

permanent link

wednesday october 11, 2006 : special feature

story links: claymation class led by ian savage at the childrens museum of the arts completes project | sponsorship: call2recycle rechargeable battery recycling corporation

Continue reading "rb_06_oct_11"

permanent link

tuesday october 10, 2006 : daily

story links: hubless bicycles, pacelman (thanks, nab!), all simpsons episodes, all family guy episodes, rb necklace ebay auction won by philip morgan, interview with united nations millennium campaign [wmv|mov], apollo pony, motion abbey, send in story ideas to stories @ rocketboom, north korea has sucessfully become a nuclear power, google buys youtube, google inks deal with bmg and time warner, rocketboom on google, goldengate.org interactive quicktime of golden gate bridge | sponsorship: call2recycle rechargeable battery recycling corporation [locale in second life]

Continue reading "rb_06_oct_10"

permanent link

monday october 9, 2006 : daily

story links: rb field correspondent chuck olsen covers leif ericson day in st. paul minnesota, new japanese inventions, inflatable restraint personal airbag for airplanes, wet shaving tutorials (via metafilter), lets knit together knitting show, firefox 2.0, firefox pacman extension (thanks, nab!), 64% of online gamers in the US are women, rocketboom 411 (thanks, joco!), is google a moron for wanting to buy youtube?, technorati daily vlog

Continue reading "rb_06_oct_09"

permanent link

friday october 6, 2006 : casual friday

story: waltz in the park

Continue reading "rb_06_oct_06"

permanent link

thursday october 05, 2006 : special feature

story link: elizabeth edwards book tour | extra: john edwards on the lord's resistance army [mov|wmv]

Continue reading "rb_06_oct_05"

permanent link

wednesday october 4, 2006 : daily

rb field correspondent steve garfied interviews peter houk the lab director of the m.i.t. glass lab on the great glass pumpkin patch [images by andrea silverman and steve garfield]

Continue reading "rb_06_oct_04"

permanent link

tuesday october 3, 2006 : field report

story links: podcast and portable media expo, cali lewis, jim kirks, zadi diaz, liberated syndication, podcast pickle, tim bourquin, rudy jahchan, tiffany young, dina kaplan, chris brogan, jason van orden, bre pettis, jake ludington, kent nichols, leesa barnes, robert walch, daniel mcvicar, paul colligan, david slusher, andrew baron, jason lee miller, matt harris, casey mckinnon, jason calacanis (and wife), robert scoble, mike hudack, dina kaplan, steve woolf, chris brogan, zadi diaz, rudy jahchan

Continue reading "rb_06_oct_03"

permanent link

monday october 2, 2006 : field report

story links: nextfest, hug shirt, kickass kung-fu, virtual canoe, virtusphere, pay by touch, digiwall, ballroom dancing, pay by touch, virginia tech ethanol hybrid car

Continue reading "rb_06_oct_02"

permanent link

friday september 29, 2006 : casual friday

story links: nextfest, paro seal robot, hubo lab einstein-y robot, playmotion, shadow robot robo-arm

Continue reading "rb_06_sep_29"

permanent link

thursday september 28, 2006 : special report

story links: a refugee camp in the heart of the city, doctors without borders

Continue reading "rb_06_sep_28"

permanent link

wednesday september 27, 2006 : field report

story links: rb field correspondent and world rps society manager graham walker on rock, paper scissors

Continue reading "rb_06_sep_27"

permanent link

tuesday september 26, 2006 : daily

story links: rocketboom ebay auction, robot travels through intestines (via new scientist tech), walking japanese robot, foobar (thanks, john c.), rb field correspondent andy carvin covers virgin music festival, wolf mother, gnarls barkley, the killers, the who, mtv virtual world (via lost remote), hotel bed jumping, scoble show

Continue reading "rb_06_sep_26"

permanent link

monday september 25, 2006 : daily

story links: christopher lydon, dave winer's first payload for rss, lydon's harvard lectures, video of lydon by david tames, podcasting word coined by dannie j. gregoire, podcast ready, podcast and portable media expo (additional events), congratulations to leo laporte of twit, podcast of the year award, all simpsons episodes for free, physics of cornstarch, chocolate marshmallow messes, cavin indoor model airplane contest

Continue reading "rb_06_sep_25"

permanent link

friday september 22, 2006 : casual friday

story links: ask joanne - rocketboom411, steven v. asks where does the white go when the snow melts, bill m. asks how is it that teflon sticks to my cooking pans, sue harvey asks why is a sidekick called a sidekick, music

Continue reading "rb_06_sep_22"

permanent link

home